KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_225387Help
Entry
BRAFLDRAFT_225387 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Enzymes [BR:bfo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     BRAFLDRAFT_225387
    1.3.1.94  polyprenol reductase
     BRAFLDRAFT_225387
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 318 aa AA seqDB search
MDACLLEVFWFSLISAFLLGWTVYTLVPSAPDFLQDLLHYGKCKVVRDDRSWLRVFDIPK
RWFSHFYYEGVVWNSFILLVTLLSFVGGVPAFWWLQEGLSFISDYPLDPPTDCNIDVVFP
TADHVSVLLALILLEFQIIRRLWECLYVSIFSDVSVHLVHYLLGLVYYLAVPISIIAEGP
KLDGETCIYTWHKLSLSDVRWSHVVGTALFIWSFWQQNKAHIILANLRKDKRGYVVTRGH
KIPYGGWFEYVSNPHYLAELLMYLSIIIVLGGEHYLSWVIQGYIAVELGLCGWITHNWYR
TKFDNYPSSRSVLIPYIF
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggatgcatgtttgctggaagtcttttggttttctttgatttcggcatttctgctcggc
tggacagtctacaccttagtgcccagcgctccggactttctccaggacctgctacactac
ggcaagtgtaaggtggtcagggatgaccgctcctggctccgagtcttcgatatccccaaa
agatggttcagccacttctactacgagggggtggtgtggaacagttttatcctgctggtg
accctgctgtccttcgtggggggcgtgccggccttctggtggctgcaggaggggctcagc
ttcatcagcgactatccactggaccctcccactgactgtaacattgatgttgtgttccct
acagctgaccatgtgtccgtgctgctggccctgatcctgttggagttccagattatccgc
agactgtgggagtgtctgtacgtgagcatcttctcggatgtgagtgtccacctggtccac
tacctgctgggtctggtgtactacctggctgtccccatctccatcattgcagagggaccc
aaactcgatggtgagacttgcatctacacctggcacaaactgagtctgtcggacgtgaga
tggagccatgtggtggggacggccttgttcatctggagcttctggcagcagaacaaggct
cacatcatcctcgccaacctgcgcaaggataaacgaggttatgtagtaacaagaggacac
aagatcccgtatggcggctggttcgagtacgtctccaacccccactacctggcggagctc
ctcatgtacctgtcaatcattatcgtcctaggaggggaacattacctcagctgggtcatt
caaggttatattgcggtggagctgggcttgtgtggctggatcactcacaactggtacaga
accaagtttgacaactaccccagcagtcgctctgtccttataccctacattttctaa

DBGET integrated database retrieval system