KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_230143Help
Entry
BRAFLDRAFT_230143 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K08601  
ubiquitin thioesterase CYLD [EC:3.4.19.12]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     BRAFLDRAFT_230143
Peptidases [BR:bfo01002]
 Cysteine Peptidases
  Family C67
   BRAFLDRAFT_230143
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 872 aa AA seqDB search
KITLRSLENHNLILECPTKDVAAISAQEAELLIAIPTCKDRFVLYEDKDRLEEGLQINVN
SVVEVSIQGVPTDVPGIVRYRGNVPGFSGITFGVELLDSKGKGTSDGTFRRKRFFNCPED
CGVFVALNKLRLRRDEHLRDLPNSASKKTNVSKAVPLSEKELSELPVKVGMRVFIFTEVN
GKESQEGGVVKYVGKLLKHGGDIYVGIELDNPVGNGSGVYEGERLFHARKDHAALVPLGG
AIPAECMASDEGTGQMVGREGDEGGREVMSEGEKEREGRKEGMSLCYCLWKGPYRLNVWQ
LIDVKRSPGAGRTQLTVNFHLSPLPPGETFSRSRQNSTCIELSPLPSASRHTDLITTFTS
PGAAGGISSPPDTLERRAGVVDPTLEVGDMVEVLGTPPRYGVIKWVGNLPDIKNERLVAG
IELDEELEACTDGTFKEKRYFTCPAKRGLFVFLDKCARDQRFEVPRPDEPPPSPSVAFGN
YNAPTIQDDTLPPESLTHDLVGKAKGIQGHHNSCYLDATLYSMFAFSSVFDVLLHRPTSR
DDLPQYGDVQRLLRENIVNPLRVEGFVRADQTLKLRQLLDQLGSIPGLLSEEKDPEEFLT
TMLKDVFKADPFLKIRSGTNKQEDCYFYQLFVEKDEKVLVPTVQQLLEQSCLATDIKITE
MPSCLLVQMPRFGRDFKIYDRVIPSLTLDITDLLENVPRECTMCGSCGEVECRDCYMEKV
FFQNNTSHIVTYCNICNLQVSHKKRRGHKPTPIQVPESFRRRHDQNGFPVPRMTMDLFAV
VCIQTSHYVAFVKCGNEPDAPWVFFDSMADRIGEQNGYNIPEVSEIPDLKQWLEDEEAIT
KQTDKELPEHVRRLLCDSYICMYQNRDVAMYK
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
aaaatcacgctacgatctttagaaaaccacaacctgattctagagtgtcccactaaggat
gttgccgccatctcagcacaggaggcggagttacttatcgccatacctacgtgtaaagac
aggtttgtgctgtacgaggataaggaccgtttggaggaggggctgcagataaacgtgaac
tcagtggtggaagtgtccatacaaggcgtgcccacagacgtacccggcatcgtcagatac
aggggcaacgtgccgggattctccgggatcacattcggggtggaattattggattccaaa
ggaaaaggcacgagtgacggcacgtttagaagaaaacgattctttaattgcccggaagac
tgcggggtttttgtagccctaaacaaattacgactacggcgggatgagcatctacgagac
cttccgaacagcgcgtctaagaaaacgaacgtctcaaaagccgttccccttagcgagaag
gaactgtctgagctgccggtgaaagttggcatgagggtgttcatatttacagaagtgaac
gggaaggagagccaagaagggggcgtggtgaagtatgtggggaaactgctgaagcacgga
ggagatatatatgtcggaattgaactggataacccagtaggaaacggctcgggtgtgtac
gagggggagaggttgttccatgccaggaaggaccatgcagcgctggtaccgctaggagga
gccatacccgccgagtgtatggcatctgatgaaggtacagggcagatggttgggagggag
ggagatgaaggagggagggaggtaatgagcgagggagagaaagagagagaaggaagaaag
gaaggaatgagcttgtgctattgcctctggaaagggccataccggctgaatgtatggcag
ctcatagatgtgaaacgttctccaggagcaggcagaactcaacttacagtgaactttcac
ctttcccctctccccccaggtgaaacgttctccaggagcaggcagaactcaacttgcatt
gaactttcacctctcccctctgcctccagacacacagatctaataacaactttcacttcc
ccaggagcggccggcgggatctcctcccctcccgacaccctggagagaagagcgggggtc
gttgaccccaccctggaggtgggagacatggtggaggtgctgggcaccccgccgcgctac
ggggtcatcaagtgggtcggcaacctgccggatatcaagaacgagagactcgtggccggg
atagaactggacgaggagttggaggcctgcacggacggcacgtttaaggagaaacgatac
ttcacctgccctgcgaagcgcggcctgttcgtgtttctggataagtgtgcccgagaccag
cggtttgaggtacccagacctgacgagccgccgccctcgccgtctgtagcctttggaaac
tacaacgcccccaccatccaggacgacaccctgccccccgagtcgctgacccatgacctg
gtggggaaggcaaagggcatccaaggtcaccacaactcctgctacctggacgccacgctg
tacagcatgttcgctttctccagtgtgttcgacgtgttgctacaccggccaaccagccga
gacgacctgccacagtacggggatgtacagagacttctgagggagaatattgtcaacccg
ctcagagttgaagggtttgtgcgagcagaccagacgctgaagctacggcagcttctggac
cagctgggctccatccccgggcttctctccgaggagaaggatcctgaagaatttctaaca
accatgcttaaagacgtcttcaaggcagacccgttccttaagatcaggtctgggaccaac
aagcaggaagactgctacttctaccagctgtttgtggagaaggatgaaaaggtgttagtg
ccaacagtgcagcagctactggagcagtcctgtctagcaacagacatcaaaatcacagag
atgcccagctgtttgctagtccagatgccgcggttcggcagagactttaagatctacgac
cgggtcatccccagcctgactctggacatcacggacttactggagaatgttcctcgagag
tgcaccatgtgtggcagctgtggcgaggtggagtgtagagactgctacatggagaaggtg
ttcttccagaacaacaccagccacatcgtcacctactgcaacatttgtaacctgcaggta
agccataagaagaggcgggggcacaagccgacgcccatccaggtcccggagtccttccga
aggaggcacgaccagaatggtttcccggtgccgcgcatgaccatggacctgttcgccgtg
gtgtgcatccagaccagccactacgtggccttcgtcaagtgcgggaacgagcccgacgcg
ccctgggtcttcttcgacagcatggcagacagaataggtgagcagaacgggtacaacatc
cctgaggtgagcgagatccccgacctgaagcagtggctggaggacgaggaggccatcacc
aagcagacggacaaggagcttcccgagcacgtgcgcagactgctgtgcgactcctacatc
tgcatgtaccagaacagagatgtggccatgtataagtga

DBGET integrated database retrieval system