KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_230181Help
Entry
BRAFLDRAFT_230181 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Glycerophospholipid metabolism
Lysosome
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:bfo00564]
Cellular Processes; Transport and catabolism; Lysosome [PATH:bfo04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 392 aa AA seqDB search
MPYSLVRVTFCFSPVPGDGGSQLEAKLNKPSSPHYFCDKTTEDYFDLWLNIELLLPYVLD
CWVDNMKLLYHKENNTVSNNVGVDIRVPGFGDTETVEWLDVSHASISSYFTNIAEALVKA
GYTRGVDIRGAPYDFRMSPYRRDIDFPMFKQLIEETYYKNNNSRVVLVTHSMGGPYGLLF
LNNMDQPWKDKFIKSMVTLAGPWGGAAKTLRLYISGDNLGIYVVNPLSLRPEQRSFPSSA
WMMPSPLLWDTNEPLVFTPDRNYTIGDYAALFDDLEYEQGWLMRKDVEGLIGDLTPPGVT
VHCLHGNKVKTPHQFSYTAKEFPDLQPSVIYGDGDGTVNLNSARGCLRWRDQQKQPVFYK
TFEGAEHMKILANQTVIEYIKDVVFSPDTSEL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgccttacagtctagttagagtgactttttgtttctccccagtcccaggagatggaggt
tcccagctggaggccaagctgaacaagccgtcctccccgcattacttctgcgacaagacg
acggaagactacttcgacctgtggctgaacatcgagctgctgcttccctacgtgctggac
tgctgggtcgacaacatgaaactgctgtatcacaaggagaacaatactgtatccaacaac
gttggagtggacatccgagtgccggggttcggggacacggagacagtcgagtggctggac
gtcagtcatgccagcatcagttcgtacttcaccaacatagcggaggcgctggttaaggca
gggtacaccagaggagtggacatccgtggagcaccctacgatttcaggatgtcaccatac
cggcgagacatagacttcccgatgtttaagcagctgatcgaggagacgtactacaagaac
aacaacagccgcgtggtgctggtgacccacagcatgggcgggccgtacgggctgctcttc
ctcaacaacatggaccagccatggaaggacaagttcatcaagtccatggtcaccctggca
ggtccctggggaggggcggccaaaacactgcggctgtacatctcaggagataacctggga
atctacgtggtgaacccgctgtcgctccgacctgagcagcgctccttccctagcagcgcc
tggatgatgccgtccccgttgctatgggataccaacgagcccctggtcttcacgcccgac
cgtaactacaccatcggcgactacgccgcgctgttcgatgaccttgagtacgagcaggga
tggctgatgaggaaagacgtggaggggctcatcggagacttgacgccgcccggcgtgacc
gtacactgcctgcatggcaacaaggtgaagacgccacaccagttctcctacacagcgaag
gagtttccggacctgcagcccagtgtgatctacggagacggggacgggacggtcaacctg
aacagcgcgcgggggtgcctccggtggcgcgaccaacagaaacagcccgttttctacaag
acgttcgaaggggcggagcacatgaaaatcctggccaaccagacagtcatcgagtacatc
aaggatgtcgtcttcagcccggacacgagcgagttgtga

DBGET integrated database retrieval system