KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_230530Help
Entry
BRAFLDRAFT_230530 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00010  Glycolysis / Gluconeogenesis
bfo00053  Ascorbate and aldarate metabolism
bfo00071  Fatty acid degradation
bfo00280  Valine, leucine and isoleucine degradation
bfo00310  Lysine degradation
bfo00330  Arginine and proline metabolism
bfo00340  Histidine metabolism
bfo00380  Tryptophan metabolism
bfo00410  beta-Alanine metabolism
bfo00561  Glycerolipid metabolism
bfo00620  Pyruvate metabolism
bfo01100  Metabolic pathways
Module
bfo_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRAFLDRAFT_230530
   00053 Ascorbate and aldarate metabolism
    BRAFLDRAFT_230530
   00620 Pyruvate metabolism
    BRAFLDRAFT_230530
  Lipid metabolism
   00071 Fatty acid degradation
    BRAFLDRAFT_230530
   00561 Glycerolipid metabolism
    BRAFLDRAFT_230530
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BRAFLDRAFT_230530
   00310 Lysine degradation
    BRAFLDRAFT_230530
   00330 Arginine and proline metabolism
    BRAFLDRAFT_230530
   00340 Histidine metabolism
    BRAFLDRAFT_230530
   00380 Tryptophan metabolism
    BRAFLDRAFT_230530
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BRAFLDRAFT_230530
Enzymes [BR:bfo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BRAFLDRAFT_230530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 7250247
NCBI-ProteinID: XP_002587582
JGI: 230530
UniProt: C3ZV58
AA seq 483 aa AA seqDB search
MTAIVQHLRENVGKMRSVEYRREQLRALLRCIDENLDRWIEVLRKDLHKVGYAFEYMSLR
TVNELIVHLNNLDEWTKPEYVKKELPQMRDECYIQYEPLGVILVIGAWNYPVQLVLCPLI
AAISAGNCAVVKPSELSEATAALVEDLLPKYLDKAMDCFAVVNGGVKETTELLEQKFDHI
MYTGNSNVGRIVMAAAAKHLTPVTLELGGKSPCYVDKDCDVDVAARRIAWGRFVNCGQTC
IAPDYVLCASQNQDRLLKGIQAALEEYFGKDPRQSEDYCRIVNQRHFHRVKSMIEKTKGS
IALGGDSDEKDLYISPTVVKDVKPTDALMEAEIFGPVLPIVTAESADDAVRFINSRDKPL
ALYAFANDKKVIHDIVQRTSSGSVCGNDTMMQMALPTLPFGGVGTSGMGNYHGKFGFLTF
SHRKAVMVKALAMEKVNSIRYPPYTEKKMSWINWLTNKKEKRRGGLFSFMPFAVIMTILA
VLL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgacagccatagtgcagcacttgcgtgagaacgtggggaagatgaggtctgtagagtac
cgacgcgagcagctgagggcactgttacgctgcattgatgagaacctagacaggtggata
gaggtactgaggaaggatctgcacaaggtagggtatgcatttgagtacatgtcactaagg
actgtgaatgagctcattgttcacttgaacaacctggatgagtggaccaagccggagtat
gtgaagaaagaactgccacagatgagggacgagtgttacatccagtacgagccgctaggt
gtcatcctcgtcatcggggcctggaactatccagtgcagcttgtcctgtgccctctcatt
gctgccatttctgctggtaactgtgctgtagtgaagccttctgagctgtctgaagccaca
gcagctcttgtggaagacctactccccaaatatctggataaggcaatggactgctttgct
gttgttaacggaggtgtgaaggagacaaccgagcttttggagcagaagtttgaccacatc
atgtacacagggaacagtaatgtgggcaggattgtgatggctgcagctgccaagcacctg
acacctgtcacactggagctggggggcaagtcaccatgctatgtggacaaggactgtgat
gttgatgttgcagcaaggcgtattgcgtggggtaggtttgtgaactgtggccaaacctgc
atcgcccctgactatgtcctgtgtgcaagtcagaaccaggacaggctactgaagggcatc
caggcagctctggaggagtactttggcaaggaccccaggcagtctgaagattactgtcgt
atcgtgaaccagcgccatttccaccgcgtcaagagcatgatagagaagacaaaaggcagc
atcgcgctcggcggggattctgacgagaaggacctgtacatcagccccaccgtggtaaag
gacgtcaaaccaaccgatgcactgatggaggcggaaatcttcggccccgtcctgccgatc
gtgaccgcagagagtgcagatgacgccgttcgtttcatcaacagtagagacaagccgctt
gcgctgtatgccttcgctaatgacaagaaggttatccacgacatcgtacagcgtacgtcc
agcgggagtgtctgcggaaatgacaccatgatgcagatggctttgcccacgctgccgttc
ggaggtgtcggtacgagcggcatggggaactaccacgggaagtttggctttctcaccttc
tcccacaggaaggcagtgatggtgaaggcactagctatggaaaaggtgaacagtatccgt
taccccccctacacggagaaaaagatgagctggatcaattggcttactaataagaaggag
aaaaggaggggtggtctcttcagcttcatgccctttgctgtgataatgaccatcctggca
gttctcctc

DBGET integrated database retrieval system