KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_230606Help
Entry
BRAFLDRAFT_230606 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Module
Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BRAFLDRAFT_230606
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    BRAFLDRAFT_230606
   00603 Glycosphingolipid biosynthesis - globo series
    BRAFLDRAFT_230606
   00604 Glycosphingolipid biosynthesis - ganglio series
    BRAFLDRAFT_230606
   00511 Other glycan degradation
    BRAFLDRAFT_230606
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    BRAFLDRAFT_230606
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BRAFLDRAFT_230606
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 506 aa AA seqDB search
MVQQTGKVLPKPQMMTVSAEAYTLAMSRFKFTYGSSSEMCDIVDQAFRRYYDLIFDVDGP
KKAPKVPESMAELTVLQVMVKEPCKGAYPSLDSSENYTLTVTAPMGMLVADSAWGVLRGL
ETFSQLIYRTDDGTMIINKTTVDDFPRFAHRGILLDTSRHFIPLKYIKQNLDAMAYNKFN
VFHWHIVDDQSFPYQSVVFPDLSAKGAFNPYTHLYTQEDVKDVIEYSRLRGIRVVPEFDT
PGHTASWGAGLPGFLTPCYDGSTPNGKYYAANPMLNTTYDYMTKLLQEVKDVFPDKHVHL
GGDEVNFNCWKSNPDITKFMEKMGFGTDYSKLEQYYIKNILDISTSIGRDYIVWQEVLDN
GVQVAKDTVVEVWKSNPPVPTEMATVTAKGLRAILSSCWYLNYISYGDDWGKYYSCEPQD
FTGTQAQKDLVIGGEACMWGEYVDGTNLIARLWPRASAVAERLWSNKDVKNMADATVRMD
EQRCRMVRRGLNAEPLHPGFCQFEYD
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggtacaacagacgggcaaagtcttgcctaagccgcaaatgatgacggtgtctgctgaa
gcctacactctggcgatgtccaggtttaaatttacatacggctcttcctccgagatgtgc
gacatcgtggaccaggcgtttaggcggtactatgatcttatattcgacgtcgatggaccg
aagaaagctccaaaggtacctgaaagcatggccgagctgactgtactacaggtcatggtg
aaagagccatgcaagggagcctaccccagcttggactcctcagaaaactacactctgaca
gttactgctccgatgggaatgctggttgctgattcagcatggggagtgttgagaggtttg
gagacattttctcagctgatatacagaacagatgatggcacgatgatcatcaacaagact
acagtagatgactttcccaggtttgcccacagaggaatcctattggacacttcccgccat
tttattcccctcaagtacatcaagcagaatttggatgcaatggcttacaacaagttcaat
gtgttccattggcacattgtggatgaccagtccttcccatatcagagtgttgtcttccct
gatctcagtgctaagggagcctttaatccttacacccacctgtacacgcaagaggatgtt
aaggatgttatagagtactcacggctgaggggcatcagggttgtgccagagtttgacacc
cctggccatacagcctcctggggtgcaggtctcccagggttcctcacaccatgttacgat
gggtccacacccaatggaaagtactacgctgctaaccccatgctgaacaccacgtatgac
tacatgactaaactgctgcaggaagtgaaggatgtgtttcctgataagcatgtccacctg
ggtggggatgaggtgaacttcaactgctggaagagtaatccagacatcaccaaatttatg
gagaaaatgggctttggaacagactattccaaactggagcaatactacatcaaaaatatc
ctggatatctccacatccatcgggagagactatattgtgtggcaggaggtgctggataat
ggtgtgcaggtggccaaggacacagtagtggaagtgtggaagagcaatcctccagtgccc
actgaaatggctacagtaacagccaagggcttgcgggccatcctttcctcatgctggtac
ctcaattacatcagctatggagatgactggggcaaatattacagctgtgaaccacaggac
ttcactggtacacaagcccagaaagacttggtgattggtggagaggcctgcatgtgggga
gagtatgtggatggcacaaacctgattgccaggctctggcctagggccagtgctgtcgct
gagcggctgtggagcaacaaggatgtgaaaaacatggcagatgcaaccgtaaggatggac
gagcagagatgtcggatggtcaggagaggactgaatgctgaacccctccatccaggattc
tgccagtttgaatatgactga

DBGET integrated database retrieval system