KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_230606Help
Entry
BRAFLDRAFT_230606 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Module
Keratan sulfate degradation
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bfo00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:bfo00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:bfo00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:bfo00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:bfo00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:bfo04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 506 aa AA seqDB search
MVQQTGKVLPKPQMMTVSAEAYTLAMSRFKFTYGSSSEMCDIVDQAFRRYYDLIFDVDGP
KKAPKVPESMAELTVLQVMVKEPCKGAYPSLDSSENYTLTVTAPMGMLVADSAWGVLRGL
ETFSQLIYRTDDGTMIINKTTVDDFPRFAHRGILLDTSRHFIPLKYIKQNLDAMAYNKFN
VFHWHIVDDQSFPYQSVVFPDLSAKGAFNPYTHLYTQEDVKDVIEYSRLRGIRVVPEFDT
PGHTASWGAGLPGFLTPCYDGSTPNGKYYAANPMLNTTYDYMTKLLQEVKDVFPDKHVHL
GGDEVNFNCWKSNPDITKFMEKMGFGTDYSKLEQYYIKNILDISTSIGRDYIVWQEVLDN
GVQVAKDTVVEVWKSNPPVPTEMATVTAKGLRAILSSCWYLNYISYGDDWGKYYSCEPQD
FTGTQAQKDLVIGGEACMWGEYVDGTNLIARLWPRASAVAERLWSNKDVKNMADATVRMD
EQRCRMVRRGLNAEPLHPGFCQFEYD
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggtacaacagacgggcaaagtcttgcctaagccgcaaatgatgacggtgtctgctgaa
gcctacactctggcgatgtccaggtttaaatttacatacggctcttcctccgagatgtgc
gacatcgtggaccaggcgtttaggcggtactatgatcttatattcgacgtcgatggaccg
aagaaagctccaaaggtacctgaaagcatggccgagctgactgtactacaggtcatggtg
aaagagccatgcaagggagcctaccccagcttggactcctcagaaaactacactctgaca
gttactgctccgatgggaatgctggttgctgattcagcatggggagtgttgagaggtttg
gagacattttctcagctgatatacagaacagatgatggcacgatgatcatcaacaagact
acagtagatgactttcccaggtttgcccacagaggaatcctattggacacttcccgccat
tttattcccctcaagtacatcaagcagaatttggatgcaatggcttacaacaagttcaat
gtgttccattggcacattgtggatgaccagtccttcccatatcagagtgttgtcttccct
gatctcagtgctaagggagcctttaatccttacacccacctgtacacgcaagaggatgtt
aaggatgttatagagtactcacggctgaggggcatcagggttgtgccagagtttgacacc
cctggccatacagcctcctggggtgcaggtctcccagggttcctcacaccatgttacgat
gggtccacacccaatggaaagtactacgctgctaaccccatgctgaacaccacgtatgac
tacatgactaaactgctgcaggaagtgaaggatgtgtttcctgataagcatgtccacctg
ggtggggatgaggtgaacttcaactgctggaagagtaatccagacatcaccaaatttatg
gagaaaatgggctttggaacagactattccaaactggagcaatactacatcaaaaatatc
ctggatatctccacatccatcgggagagactatattgtgtggcaggaggtgctggataat
ggtgtgcaggtggccaaggacacagtagtggaagtgtggaagagcaatcctccagtgccc
actgaaatggctacagtaacagccaagggcttgcgggccatcctttcctcatgctggtac
ctcaattacatcagctatggagatgactggggcaaatattacagctgtgaaccacaggac
ttcactggtacacaagcccagaaagacttggtgattggtggagaggcctgcatgtgggga
gagtatgtggatggcacaaacctgattgccaggctctggcctagggccagtgctgtcgct
gagcggctgtggagcaacaaggatgtgaaaaacatggcagatgcaaccgtaaggatggac
gagcagagatgtcggatggtcaggagaggactgaatgctgaacccctccatccaggattc
tgccagtttgaatatgactga

DBGET integrated database retrieval system