KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_231428Help
Entry
BRAFLDRAFT_231428 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K05466  
angiopoietin 2
Organism
bfo  Branchiostoma floridae (Florida lancelet)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 214 aa AA seqDB search
DCAAYKASGQTTSGVYPLDSLPSGVQAYCDMDTAGGGWTVVQRRQDGSVPFNRTWEEYKL
GFGDPGGEYWLGNENIHLLTNQKEYLLRVELQDWEGNQTFAEYSTFRVSGESDGYRLHIS
GYSGTAGDSMTGRPSNNGQRFSTVDRDNDASSGSCSQRYGQGGWWFNKCGYSYLNGRYLG
NCENSCPAVQGVLWHHWRGGSYSLKSVSMKIRAS
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
gactgtgctgcatataaagcctccggacagacgaccagcggagtctacccactcgactcc
ctcccgtccggtgtgcaggcctactgtgacatggatactgcaggaggcggatggaccgtg
gtccagcggcggcaggatgggtcggttcccttcaaccggacctgggaggagtacaaactg
ggctttggagacccgggcggggagtactggctggggaacgagaacatccacctcctgacc
aatcagaaagagtacttgctgcgagttgaactgcaggactgggaagggaatcagacattc
gcagaatacagcacatttagggtgtccggagagtcggacgggtaccggctgcacatttcc
gggtattcaggcaccgcgggagactccatgactggccggccctcaaacaacgggcagagg
ttctccactgtggacagggacaatgatgccagcagcggcagttgttcccagcggtacgga
cagggcggctggtggtttaacaaatgcggctactcctacctcaacggccgttacttgggc
aactgtgagaactcctgtccagcagtgcaaggtgtgctgtggcaccactggagaggcggg
agctactctctgaagtctgtgtctatgaaaatcagggcatcataa

DBGET integrated database retrieval system