KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_237252Help
Entry
BRAFLDRAFT_237252 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    BRAFLDRAFT_237252
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     BRAFLDRAFT_237252
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 246 aa AA seqDB search
MKFLQIEANLCETLRHLVFRDPVTHLYNPLDYARETHKDYVMKYCCSHKDVLFLGMNPGP
FGMAQNGVPFGDTTFVKDFLKISGNVNPPALQHPKRLITGLACTHSEVSGTRFWGLFRTL
CKTPENFFRRCFVHNYCPLVFMTKTGKNVTPPSLHMTQREPLLSACDTALVEVIRLLQVK
MIVGVGRFAQERAQYALKMTGLNIPVLFIMHPSPINPQANKGWAEQMMVEFEKLGIMRYL
VPKSKG
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcttacagattgaggcaaacttgtgcgagacgttgagacacctcgtgtttcgg
gatccggtcacgcatttgtacaatcctctggactatgcgcgggagacacataaggactac
gttatgaagtactgctgttctcacaaagatgtgctgttcttagggatgaaccctggtcct
tttggaatggctcagaatggggttccttttggtgacaccaccttcgtgaaggactttctg
aagatcagcggaaacgtgaatccaccggccctccagcaccctaaacgactaatcacgggc
ctggcctgcacgcacagcgaggtgagcggaactcgtttctggggccttttccgtacgctc
tgcaaaacgcccgagaacttctttcggcggtgttttgttcacaactattgccccctcgtg
ttcatgaccaaaacggggaagaatgtcaccccgccaagtttacacatgacgcagcgagag
ccgttgctaagtgcgtgtgacaccgctctggtcgaggtgatccggttgctccaggtgaaa
atgatcgttggcgtgggaaggttcgcccaggagcgggcccagtacgcgctgaaaatgacg
gggttgaatattccagttttgttcataatgcatccgagccccatcaaccctcaggccaac
aaagggtgggctgaacagatgatggtagagtttgaaaagttaggcattatgaggtacctg
gtacccaagtctaaaggttag

DBGET integrated database retrieval system