KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_239705Help
Entry
BRAFLDRAFT_239705 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:bfo04068]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:bfo04150]
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:bfo04140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 492 aa AA seqDB search
TVGEHALTGHKVAVKILNRQKIKSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPADIF
MVMEYVSGGELFDYIVKHGKLKEAEARRFFQQIISGVDYCHRHMIVHRDLKPENLLLDSN
RNVRIADFGLSNMMADGEFLRTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCG
TLPFDDEHVPTLFKKIKGGVFPIPDHLSPTVVGLLRHMLEVDPVKRATIPEISAMLLGQK
PICLFALFCREHEWTKIDMPAYLFPLDEQDTNVVDYDAVREVCEKFECKETEVISGLLGG
DPHNPLAVAYHLIVDNKRIEREAAKNMKMKDWYLATSPPPETSFIEERMVAPPISPLKPF
PDRPSKPTTSTSSCVPSSALDTLISTERRLPTPSKKAKWHLGIRSQSKPHDIMSEVYRAM
KQLNYEWKMVNPFHLRVRRKNPVTQRYAKMSLQLYQVDQKSYLLDFKSLSNAPDPEDGGG
SSMFAFSSSTKP
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
acagttggagagcatgccctgaccggtcacaaggtggctgtaaagatcctgaaccggcag
aaaatcaagagtttggacgtggtggggaaaatccggcgcgagattcagaacctgaagctc
ttcagacatccacatatcatcaaactgtatcaggtgatcagcacacctgctgacatcttt
atggtgatggagtatgtatccgggggagaactgtttgattacatcgtcaaacatggcaag
ctgaaggaagctgaggcccgtcggttcttccagcaaatcatatcgggtgtggactactgt
cacaggcacatgatcgtacacagggacctgaaacctgagaacctcctactggactccaac
agaaatgttagaatagctgattttggcctctctaacatgatggcggatggagagtttctc
cgtaccagttgtggatcaccgaactacgccgcaccagaagtcatctccggaaaactgtat
gcaggtccagaggtagatgtgtggagctgtggggtcatcctgtatgctttactctgtgga
actcttccgtttgatgatgaacatgttccaacactgttcaagaaaattaaaggaggggtg
ttccccatcccagaccacctgtcccccactgtggtgggattactcaggcacatgttggag
gtggatccagtcaagcgggctaccatccctgagatcagcgccatgctcctaggtcaaaaa
ccaatttgtctgttcgctttattctgtagagaacacgagtggacaaagatcgatatgccc
gcgtacttgttcccattggacgagcaagacacgaacgtggtagactatgacgctgtgagg
gaagtgtgtgagaaatttgagtgtaaggagacggaagtgatcagtggcctcctgggcgga
gaccctcacaacccgctcgccgtggcgtaccatcttatcgtggacaacaagcgcatcgag
agagaagctgccaagaacatgaagatgaaggactggtaccttgcaacaagcccccctccc
gagacatccttcatcgaggagagaatggttgctcctcctatttcgcccctcaagcctttc
ccggacagaccaagtaagccgacaacttccacgtcttcttgtgttccttcctcggccctg
gacactcttatatccaccgagagacggctacctaccccctccaagaaggccaaatggcat
ctaggtatccgctctcaaagcaagccccatgacataatgagtgaggtgtacagagctatg
aagcagctcaactatgaatggaaaatggtgaacccctttcatttgagagtaaggaggaaa
aacccagtgacacaaagatatgccaagatgagtctgcagctgtaccaggtggaccagaag
agttacctgctggacttcaagagcctcagcaatgctcctgacccagaagatggtggagga
agcagtatgtttgcatttagctcttctactaaaccatga

DBGET integrated database retrieval system