KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_244533Help
Entry
BRAFLDRAFT_244533 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BRAFLDRAFT_244533
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    BRAFLDRAFT_244533
Enzymes [BR:bfo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     BRAFLDRAFT_244533
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 456 aa AA seqDB search
MSKFRAPDVIAKKRDGQVLTTGEIQYFVKGVVEKEFQDSQIGAMLMAIFLNGMNRDETTT
LTRAMRDSGSTLSFPAEWAGLVVDKHSTGGVGDKISLPLAPALAACGLKVPMISGRGLGH
TGGTLDKLESIPNFSVDCTTGEMGDILGKVQYSYNVVLIVGCCIVGQTADIVPADKIMYG
IRDVTGTVESLPLITASIVSKKASEGLSALVLDVKYGQAAFMKTLDKARDLAHSMVSASE
GLGVKTVALLTRMDNPIGLTIGNGLEVWESLLCLQGEGPQDLKELVCQLGGHLLARVGTA
ATAAEGAERIAEKLRNGKALQKFCDMMVAQGVKQETAEALCCPGTDVFTILPRAQHVEDL
CCQSSGFIQSIDALELARVSAELGAGRSKAGEAVNHAVGLQLLKTVGAKVTKGDVWVKVH
HQGDCVSPNHITRLQNSLLVGGESVEVGSRVTEVIS
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagtttcgtgctccagatgtcatagcgaagaaacgagacgggcaagttctcact
acaggagaaatccagtactttgtaaaaggagtggtggagaaagagtttcaagacagccag
atcggtgccatgttgatggccatcttcctgaatgggatgaacagagacgagaccaccaca
ctgactcgtgcgatgagagactcggggagcacgctcagctttcccgcggagtgggcgggg
ctcgtcgtggataaacactccacgggaggggtcggagacaagatcagccttccgctcgca
cccgccttggcagcctgcgggttaaaggttcccatgatctcaggacgaggcctgggccac
accggagggactctggacaaactggagtctataccgaacttctctgtggactgtaccact
ggtgagatgggggacatactgggaaaggtacagtacagttacaatgtagttcttattgtt
gggtgctgtattgttggccagactgcagacattgttcctgcagacaaaatcatgtatggc
atcagggatgtcactggtactgtggagtctctcccactcatcacagcttctatagtctct
aagaaggcttctgagggcctgtctgcactggtgctggatgtgaagtatggccaggcagcc
ttcatgaagaccctggacaaggctagggacctggcacacagtatggtgtcagccagtgag
gggctgggagtgaagactgtggccctgctgaccagaatggacaaccccatcggactgacc
attggtaatggcctggaggtgtgggagagtctattatgtcttcagggggaggggccacag
gatctcaaggagctggtctgtcagcttggaggccatctactggctcgtgtgggtactgca
gccacggcagcagagggagctgagaggattgcagagaagctgagaaatgggaaggcctta
cagaagttctgtgacatgatggtggcacaaggtgtgaagcaggagacagcagaggcactg
tgctgcccaggcactgatgtcttcaccatcctgccccgggctcaacatgtggaggatctc
tgctgtcaaagtagtggatttatccagtctatcgatgccctggagttggcgcgagtgtca
gcggagctcggagcagggcggtctaaagcgggggaggctgtcaatcatgcagtcgggctg
cagctgctgaaaactgtgggggcaaaggtcacaaaaggggatgtttgggtcaaggttcat
caccaaggagattgtgtctcacccaatcacatcacaaggctgcaaaactcccttcttgtt
ggaggggaaagtgtggaggttggttctagggtcacggaggtcatttcttag

DBGET integrated database retrieval system