KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_244533Help
Entry
BRAFLDRAFT_244533 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bfo00240]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:bfo00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 456 aa AA seqDB search
MSKFRAPDVIAKKRDGQVLTTGEIQYFVKGVVEKEFQDSQIGAMLMAIFLNGMNRDETTT
LTRAMRDSGSTLSFPAEWAGLVVDKHSTGGVGDKISLPLAPALAACGLKVPMISGRGLGH
TGGTLDKLESIPNFSVDCTTGEMGDILGKVQYSYNVVLIVGCCIVGQTADIVPADKIMYG
IRDVTGTVESLPLITASIVSKKASEGLSALVLDVKYGQAAFMKTLDKARDLAHSMVSASE
GLGVKTVALLTRMDNPIGLTIGNGLEVWESLLCLQGEGPQDLKELVCQLGGHLLARVGTA
ATAAEGAERIAEKLRNGKALQKFCDMMVAQGVKQETAEALCCPGTDVFTILPRAQHVEDL
CCQSSGFIQSIDALELARVSAELGAGRSKAGEAVNHAVGLQLLKTVGAKVTKGDVWVKVH
HQGDCVSPNHITRLQNSLLVGGESVEVGSRVTEVIS
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagtttcgtgctccagatgtcatagcgaagaaacgagacgggcaagttctcact
acaggagaaatccagtactttgtaaaaggagtggtggagaaagagtttcaagacagccag
atcggtgccatgttgatggccatcttcctgaatgggatgaacagagacgagaccaccaca
ctgactcgtgcgatgagagactcggggagcacgctcagctttcccgcggagtgggcgggg
ctcgtcgtggataaacactccacgggaggggtcggagacaagatcagccttccgctcgca
cccgccttggcagcctgcgggttaaaggttcccatgatctcaggacgaggcctgggccac
accggagggactctggacaaactggagtctataccgaacttctctgtggactgtaccact
ggtgagatgggggacatactgggaaaggtacagtacagttacaatgtagttcttattgtt
gggtgctgtattgttggccagactgcagacattgttcctgcagacaaaatcatgtatggc
atcagggatgtcactggtactgtggagtctctcccactcatcacagcttctatagtctct
aagaaggcttctgagggcctgtctgcactggtgctggatgtgaagtatggccaggcagcc
ttcatgaagaccctggacaaggctagggacctggcacacagtatggtgtcagccagtgag
gggctgggagtgaagactgtggccctgctgaccagaatggacaaccccatcggactgacc
attggtaatggcctggaggtgtgggagagtctattatgtcttcagggggaggggccacag
gatctcaaggagctggtctgtcagcttggaggccatctactggctcgtgtgggtactgca
gccacggcagcagagggagctgagaggattgcagagaagctgagaaatgggaaggcctta
cagaagttctgtgacatgatggtggcacaaggtgtgaagcaggagacagcagaggcactg
tgctgcccaggcactgatgtcttcaccatcctgccccgggctcaacatgtggaggatctc
tgctgtcaaagtagtggatttatccagtctatcgatgccctggagttggcgcgagtgtca
gcggagctcggagcagggcggtctaaagcgggggaggctgtcaatcatgcagtcgggctg
cagctgctgaaaactgtgggggcaaaggtcacaaaaggggatgtttgggtcaaggttcat
caccaaggagattgtgtctcacccaatcacatcacaaggctgcaaaactcccttcttgtt
ggaggggaaagtgtggaggttggttctagggtcacggaggtcatttcttag

DBGET integrated database retrieval system