KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_247066Help
Entry
BRAFLDRAFT_247066 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K07434  
aromatase [EC:1.14.14.14]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Metabolic pathways
Module
C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
Enzymes [BR:bfo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.14  aromatase
     BRAFLDRAFT_247066
Cytochrome P450 [BR:bfo00199]
 Cytochrome P450, animal type
  CYP19 family
   BRAFLDRAFT_247066
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 454 aa AA seqDB search
MSSISTGPPWLLGFGPLMSFARFIWMGVPVAAAHYGARYGDFVRVWIAGERTYVITRPSA
AWHVLKSNNYCRRFGSRTGLSTIGMYQNGIIWNGDDGWRVLRGFFQKALNADTLNRATSA
AVDATYRQMGNIAALQQKAADGKIEALDFLRRITLEVTNNLTLGVHIADPDDLVERIVRY
FKAWEFFLLRPPIMYLMTPKLYWKHCQAVNDLNDAIAELLTNKRQELKTAPPSDKPDFAT
CLLQAEERGEVSPAHVQQCVLEMLLAGTDTSSVSMYYLLVSVAENPQVELKVLEEMRDIL
GERDPTKADLPQLVYLEQVIKEAMRIKPVGPVIMRQAKEDDRIDGIETPAGTNIILNLAD
MHRRQDNFPAPDDFNPQHFDNKDFKGEYVPFGTGPKGCIGQFLAMIEMKAIMCTLLRKHH
LRAIPGESLEGIETHWDIAQQPVNASYMYFEERN
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctatatcaacaggccccccctggttacttggtttcggtccgttgatgagtttt
gcccggtttatctggatgggtgttcccgtggccgcggctcattacggagcgcgctatggg
gactttgttcgtgtgtggattgcaggagagcggacctacgtcataacccggccgtccgct
gcctggcacgttttgaagtctaacaactactgccggcggttcggcagcaggacggggctc
agcaccatcggcatgtatcagaacggcatcatatggaacggggacgacggctggagggtg
ctcagggggttctttcaaaaagctctcaacgcggataccctgaatcgagctacgtctgca
gccgtggacgccacctaccggcagatgggtaacattgcagctctgcagcagaaggcagct
gatgggaaaattgaagctcttgacttcctgcggcggatcacactagaggtcaccaacaac
ctcacactgggcgtgcatattgcagatccggatgatcttgtagaaagaatcgttcgctac
ttcaaggcgtgggaattcttcctcctgcggcctcccatcatgtacctgatgacacctaag
ctgtactggaagcactgtcaggctgtgaatgacttgaatgacgctatcgctgagcttctg
acaaacaagagacaggagttgaaaacagcgccacctagtgataagcctgactttgccacc
tgtctgctgcaagctgaggagagaggtgaggtgagcccagcacatgtgcagcagtgtgta
ctggagatgctgctggcgggtacagacacgtcctccgtctccatgtactacctgctggtg
tctgtggcagagaacccgcaggtcgagctgaaagtcttggaggagatgagagacatcctg
ggagagcgtgaccccacaaaggctgacctgccacagctagtgtacctggagcaggtgatt
aaggaggccatgaggatcaagccagtgggcccggttatcatgcgccaagctaaggaggac
gacaggattgatgggattgagactcctgctggtactaacatcatcctgaacctggcagac
atgcacagacgccaggacaacttcccagcaccggatgacttcaacccgcagcactttgac
aacaaggacttcaagggcgagtatgttccctttggcacaggtcctaagggctgcataggt
cagttcctggctatgattgagatgaaggccatcatgtgtaccctgctgcgcaagcatcat
ctgcgtgcaataccgggggagtcgctagagggcatcgagactcactgggacatcgcacaa
cagcctgtcaatgctagttacatgtactttgaagagaggaactag

DBGET integrated database retrieval system