KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_247066Help
Entry
BRAFLDRAFT_247066 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K07434  
aromatase [EC:1.14.14.14]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Metabolic pathways
Module
C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 454 aa AA seqDB search
MSSISTGPPWLLGFGPLMSFARFIWMGVPVAAAHYGARYGDFVRVWIAGERTYVITRPSA
AWHVLKSNNYCRRFGSRTGLSTIGMYQNGIIWNGDDGWRVLRGFFQKALNADTLNRATSA
AVDATYRQMGNIAALQQKAADGKIEALDFLRRITLEVTNNLTLGVHIADPDDLVERIVRY
FKAWEFFLLRPPIMYLMTPKLYWKHCQAVNDLNDAIAELLTNKRQELKTAPPSDKPDFAT
CLLQAEERGEVSPAHVQQCVLEMLLAGTDTSSVSMYYLLVSVAENPQVELKVLEEMRDIL
GERDPTKADLPQLVYLEQVIKEAMRIKPVGPVIMRQAKEDDRIDGIETPAGTNIILNLAD
MHRRQDNFPAPDDFNPQHFDNKDFKGEYVPFGTGPKGCIGQFLAMIEMKAIMCTLLRKHH
LRAIPGESLEGIETHWDIAQQPVNASYMYFEERN
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctatatcaacaggccccccctggttacttggtttcggtccgttgatgagtttt
gcccggtttatctggatgggtgttcccgtggccgcggctcattacggagcgcgctatggg
gactttgttcgtgtgtggattgcaggagagcggacctacgtcataacccggccgtccgct
gcctggcacgttttgaagtctaacaactactgccggcggttcggcagcaggacggggctc
agcaccatcggcatgtatcagaacggcatcatatggaacggggacgacggctggagggtg
ctcagggggttctttcaaaaagctctcaacgcggataccctgaatcgagctacgtctgca
gccgtggacgccacctaccggcagatgggtaacattgcagctctgcagcagaaggcagct
gatgggaaaattgaagctcttgacttcctgcggcggatcacactagaggtcaccaacaac
ctcacactgggcgtgcatattgcagatccggatgatcttgtagaaagaatcgttcgctac
ttcaaggcgtgggaattcttcctcctgcggcctcccatcatgtacctgatgacacctaag
ctgtactggaagcactgtcaggctgtgaatgacttgaatgacgctatcgctgagcttctg
acaaacaagagacaggagttgaaaacagcgccacctagtgataagcctgactttgccacc
tgtctgctgcaagctgaggagagaggtgaggtgagcccagcacatgtgcagcagtgtgta
ctggagatgctgctggcgggtacagacacgtcctccgtctccatgtactacctgctggtg
tctgtggcagagaacccgcaggtcgagctgaaagtcttggaggagatgagagacatcctg
ggagagcgtgaccccacaaaggctgacctgccacagctagtgtacctggagcaggtgatt
aaggaggccatgaggatcaagccagtgggcccggttatcatgcgccaagctaaggaggac
gacaggattgatgggattgagactcctgctggtactaacatcatcctgaacctggcagac
atgcacagacgccaggacaacttcccagcaccggatgacttcaacccgcagcactttgac
aacaaggacttcaagggcgagtatgttccctttggcacaggtcctaagggctgcataggt
cagttcctggctatgattgagatgaaggccatcatgtgtaccctgctgcgcaagcatcat
ctgcgtgcaataccgggggagtcgctagagggcatcgagactcactgggacatcgcacaa
cagcctgtcaatgctagttacatgtactttgaagagaggaactag

DBGET integrated database retrieval system