KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_259602Help
Entry
BRAFLDRAFT_259602 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 606 aa AA seqDB search
MGSNGGVTKMVAYISVATPSSKIDDKEVNFLFVDKSGDTIGVATLRMTAFYVSLDVDCDR
DGVVEKNNPNKASWKWGPDGHGAILLVNNDCDDYLLEMDPEHKNSKIDGPFDLEDMSRMS
VRVRGPDTLPEDCKLRMWVRPDDKERLGIFNLSDIQSTTVMIHIIGPKAGHLAQISYDLM
MAGGTGEGETLFAVEGLKYPDRDFNGTLRIHLSLLKNAAVPVFEDTVMFRLAPWIMTPNT
LEPVEAFTCQMKKKENIDFVNDFTKVVEAAGIKLNIVLPYENRGDRWMQDEIELGYSELP
GKKPMPVVLDSPRDRGLQKFPKGKLLGPDFGYVTRYDQNEYVNSLDSFGNLEVSPPVKVD
GRTYPMGRILLGSAFPTYYGRRMMRVVRDFLYAQQVQPPVELFSDWLAVGHIDEFMSFVP
AAGGKGFRLLLASPAACYNLLRKLKDQGHGDVLCFEGRTRHGESAEKSISDLLDDADLKA
ESMQCQNDIDWNRDVMKRELGLDEGDIIDLPQLFQLEEGSGAGAYFPDMVNMIVLGKHLG
IPKPFGPMIDGECAIETNVRSLLEPLGLTCNFVNDWDSYHLLMGEVHCGSNTRRKPFDFK
WWNMSF
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcaatggtggggtcaccaagatggtggcctacatttctgttgccactcccagc
tccaagatcgatgacaaggaggtgaactttctctttgtggacaagagcggagacaccatc
ggcgtggccacactgcgcatgacagctttttacgtgtcgcttgacgtggactgtgacagg
gatggagtcgtggagaaaaacaacccaaataaggcatcctggaagtggggtccagacgga
cacggcgcgatactcctggtcaataacgactgtgatgactacctgctggagatggaccct
gaacacaagaacagcaagatagatgggccatttgacctggaggacatgagtaggatgtcc
gtgcgtgtcagaggaccggacacgctgcctgaggactgtaagctgcgcatgtgggtccgg
cctgacgacaaggagcgtctggggatcttcaacctcagcgacatacaaagtacgacagtg
atgatacacattatcggccctaaggcgggccacctggcgcagatctcgtacgacctgatg
atggccgggggtacgggtgagggagagacgctgttcgcggtggaggggctgaaatacccg
gacagggacttcaacggaaccctgcggattcacctcagtctgctgaagaacgccgcagtc
ccagtgtttgaagacacagtgatgttccggttggcaccttggatcatgaccccgaacact
ctggagcccgtagaagccttcacctgccagatgaagaagaaagaaaacatcgacttcgtc
aatgactttacaaaagtggtggaagcggccggcataaagttgaacatcgtgctgccatac
gagaacaggggagaccgttggatgcaggatgagatcgagctcgggtactcggaacttccc
ggaaagaagccgatgcctgtcgttctggactcgccacgtgaccgcgggctgcagaagttc
cccaaggggaagctgctgggcccagatttcgggtacgttaccaggtatgaccagaacgag
tacgtaaactcactggactccttcggcaacctggaggtcagccctccggtcaaagtcgac
ggaaggacgtacccgatggggaggatcctgctggggtctgcttttcctacgtattacggc
cgccggatgatgcgcgtggtccgtgacttcctgtacgcccagcaggtgcagccccccgtg
gagctcttctctgattggctggccgtcggccatattgatgagttcatgtccttcgtaccg
gcggctggtggaaagggattccgtctcttgctggccagccctgctgcctgctacaatctt
ctgcgcaagctcaaggatcagggtcatggtgacgtgttgtgctttgaggggaggaccagg
catggcgaaagcgcagaaaagagcatcagtgaccttctagatgatgccgatctcaaggct
gaaagtatgcagtgccagaacgacatcgactggaaccgagacgtgatgaaacgggagctg
ggattggatgaaggtgacatcatcgatctcccacagctgttccagcttgaggaggggtct
ggagcgggtgcgtactttcccgacatggtcaacatgatcgttctcggcaagcacctcggg
atcccgaagccgtttggccctatgatcgacggtgaatgcgccatcgagacgaacgttcgg
tccctcctggagccgctcggactcacgtgcaacttcgtcaacgactgggactcctaccac
ctcctgatgggcgaggtgcattgtgggagcaacactcggcgaaaaccgtttgatttcaaa
tggtggaatatgtcgttttag

DBGET integrated database retrieval system