KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_259924Help
Entry
BRAFLDRAFT_259924 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00600  Sphingolipid metabolism
bfo01100  Metabolic pathways
Module
bfo_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BRAFLDRAFT_259924
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     BRAFLDRAFT_259924
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 7212800
NCBI-ProteinID: XP_002595538
JGI: 259924
UniProt: C3Z6V4
AA seq 333 aa AA seqDB search
MLGESDISFNMVVTERSGHAHDLMRDLEVSQWSGVVVVSGDGLIYEVINGLMDRPDWEEA
IKMPIGLIPGGTGNALCCSVNYLLDEPFESADQVLHSTFVLCKSVVSGSSYPMDLVSVQT
KSSHIFSFLHISWGFISDIDIGSEKYRYLGDARFFVGLVQRLFDLRKYPGHVSYLPVKGV
DGRAHTMPNPDSEARRHGPVDALLPPLGQPLPDGWVTVEGDFNLVMALNVPHISTGFNMS
PASQLDDGMMFLMYAMNTTRSEMSNISFKASQGRIGEVEQAGTDVIAVHAFRLEPQGDKG
LITADGEVIEYGPLQAQVHRSLARVLMWKPVEI
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgttgggcgagtctgacatcagcttcaacatggtggttactgagcgttctggccacgcc
catgacctgatgcgggatctggaggtgtcccagtggagtggggtggtcgtggtgtcagga
gacgggctcatatatgaggttatcaatggcctgatggaccgtccagactgggaggaggcc
atcaagatgcccatcggcctgatcccggggggaacgggcaacgccctctgctgctctgtc
aactatctactggatgagccgtttgagtcagccgaccaggtcctccactccacgtttgtc
ctgtgcaagagtgttgtgtccggcagcagctaccccatggacctggtgtctgtacagacc
aagtcctcccacatcttctccttcttacatatcagctgggggttcatctccgatatcgac
atcgggagcgagaagtatcgctacctcggtgacgcccgctttttcgttggactggtgcag
cggctgtttgacttgcggaagtaccccgggcacgtgtcgtaccttcccgtgaagggggtg
gacgggagagcccacacaatgccaaacccagacagtgaagccagacgtcacggtcccgtc
gacgccctcttgccccccctggggcagcccctccccgatggctgggtgacggtggaggga
gactttaacctggtgatggctctgaacgtgcctcacatcagcacaggcttcaacatgtcc
ccagccagccagctggacgacggcatgatgttcctgatgtatgccatgaacaccacgcgt
agcgagatgtccaacatctccttcaaggcttcgcaggggaggatcggcgaggtcgagcag
gcgggaacggacgtgatcgctgtccacgcgttcaggctggagccgcagggggacaagggt
ctaatcactgcggacggggaggtcatcgagtacggaccactgcaagcacaggtgcaccgg
tcactggctcgggtactgatgtggaagccagtagagatttga

DBGET integrated database retrieval system