KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_264545Help
Entry
BRAFLDRAFT_264545 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
FoxO signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:bfo04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1046 aa AA seqDB search
MEEEDESRAEATFRFTVENFSKVKETQLSPPVFIRNLPWKIMAMPRHNPNAERPNNKSLG
FFLQCNADSDSSWSCSASAELRLIPQKDGVETFNRKIQHIFYSKENDWGFAHFMPWHEVG
DPAKGFIKDDRILLEVYVNADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQ
LRKAVYQMPTESDDQSKSVALALQRIFYELQHNDKPVGTKKLTKSFRWETLDSFMQHDVQ
ELCRVLLDNMESKMRGTCVEGTIPRLLEGKMISFIKCKHIDYMSSRTEPFYDIQLNIKGK
KNLYESFQDYIATETMDGENKYDAGKFGLQEAEKGVIFQSFPPVLHLHLMRFVYDPNTDT
NIKINDRCEFHERINLDKFVQNPDTKDPAVYILHAVLVHSGDNHGGHYVVYLNPRGDGKW
CKFDDDVVSRCTKAEAIDHNFGGFDDDISIRHCTNAYMLVYVRESCKDEVLCPVNEIDIP
DNLIERLAEEKKYELQRRKERSEAHLYMPVHVVTEDQFCGHQGNDMFDMEHVHYRTFKVL
REMKLGPFMEMLAGSMGYPVEQIRPWPFQQRSNCTFRPTMIDIENDLEKSVVVLAENDPP
WYVFLECVEPDSDVKSLPPFDKDSDVMLFLKMYDPKAKMICYAGHVYVPISTRVEELIPI
MNRRAGFRSDTDLIMFEEVKPNLVERIQDYELPLDKALDELMDGDIIIFQKDDPENEECE
LPTAKDYFRDLYYRVDVVFCDKTIPSDTGFNLVLSQRMNYFQVAKCVAQELGTDPMLLQF
FKTQGYRDAPGNPLRCTYEGTLKDLLSNLKQRGPKKLYYQRLRIPINELENKRQFKCIFV
NSKLKEDREMVLYPSKNGTVADLLEEAGKQLQLPQDGGSGKLRLLEVISNKIFCVQKEDV
LLECLNSQGTKTYRIEEIPQEELSIREEELLIHCAHFSKEVFATFGTPFMVKIRQGESFA
AIRGQIQKKLDVPDKEFEKYQFAIIVMGRQTYIPEEYSVELKDFLPQMVPGGAMQPKPWL
GIDHINKTAKRSRPYMYTEKAIKIHN
NT seq 3141 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagaagacgagtctcgagccgaggcgaccttccgcttcaccgtggagaacttc
agcaaggtcaaggagacgcagctgagtccgcccgtcttcatccgcaacctcccgtggaag
attatggccatgcctcggcacaacccgaacgcagagcgccccaacaacaagagcctgggg
ttctttctgcagtgcaacgcagactccgacagttcttggtcctgcagcgcgtccgcagaa
ctgcggctcataccgcagaaggatggggttgagacgtttaaccgtaagatccagcacatc
ttctatagcaaggagaatgactggggcttcgctcacttcatgccgtggcacgaggtcggc
gaccccgcgaaggggttcatcaaggatgaccggattcttctcgaagtttacgtgaacgcg
gacgcgccgcacggcgtggcctgggactctaagaagcacacgggctacgtgggtctgaaa
aaccagggcgccacctgttacatgaactcgttactgcagactctcttcttcacaaaccag
ctgcgcaaggccgtgtaccagatgcccacggagagcgacgaccagtcgaagagcgtcgcg
ctcgccctacagaggatattctacgagcttcagcacaacgataaacccgtgggaactaag
aagctgacgaagtcgttccgctgggaaactctcgactccttcatgcagcatgacgtacag
gagctttgccgcgtgttgctagacaacatggagagcaagatgcggggaacatgtgtcgaa
gggaccatcccgcggcttctggagggaaaaatgatctcctttatcaaatgcaaacacata
gactacatgtcgtcgcgcactgagcccttctacgacatccagctcaacatcaagggcaag
aagaacttgtacgaatcattccaggactatatcgccacggaaacaatggacggggagaat
aagtacgacgcgggaaagttcgggttgcaggaggcggagaagggcgtgattttccagagt
ttcccgccggttcttcacctgcacctcatgaggtttgtttacgacccgaacaccgacacc
aacatcaagatcaacgaccgctgcgagttccacgagcggatcaacctggacaagttcgtc
cagaaccctgacacaaaggatccagctgtgtacatcctccatgcagtcttagtgcacagt
ggggacaaccacggtggccactatgtcgtctacttgaacccacgcggcgatgggaagtgg
tgcaagttcgatgatgatgtggtctcgcgctgcacgaaagccgaggcgatcgaccacaac
tttggcggcttcgatgacgacatttccatcagacactgcacgaacgcctacatgttggtg
tacgtacgggagagctgcaaggatgaggtcctgtgtcctgtcaacgagatcgacatcccg
gacaacctgattgagagactcgccgaggagaagaaatacgagctgcagcgccggaaggag
cgtagcgaggcgcacctgtacatgcccgtgcacgtcgtcacggaagaccagttctgtggt
caccaaggcaacgacatgttcgacatggaacacgttcactacaggacttttaaggttctc
cgcgagatgaagctcgggcccttcatggagatgttggccgggtctatgggttatccggtg
gagcaaatccgcccttggccgttccagcaacgtagcaactgtaccttccgccccaccatg
attgacattgagaacgaccttgagaagagcgtggtggtgctggcggagaacgacccgccc
tggtacgtgttccttgagtgtgttgagccggactcggacgtgaagtccctcccgcccttc
gacaaggactcggacgtgatgctgtttctgaagatgtacgacccgaaggctaagatgatc
tgctacgcgggacatgtgtatgttcccatcagcacccgggtggaggaactcatccccatc
atgaatcgccgggcggggttccgtagcgacacagacctcatcatgttcgaagaggtgaag
cccaaccttgtggagcgtatccaggactacgaactcccgctggacaaggctctggacgag
ctcatggacggtgacatcatcatcttccagaaggacgatccggagaatgaggagtgcgaa
ctcccaacagctaaagactacttcagggacctgtactaccgagtggacgtggtgttctgt
gacaagacgattcccagcgatactggcttcaacctcgtcctgtctcagagaatgaactac
tttcaggttgcaaagtgcgttgcccaggagctgggcacagaccccatgctgctgcagttc
ttcaagacgcagggttaccgggacgcgcccggtaacccgctgcgatgcacgtacgagggg
acgctgaaggacctcctcagcaacctgaagcagcgcgggcccaagaagctgtactaccag
cgcctccgcatccccatcaacgagctggagaacaagagacagttcaagtgcatcttcgtt
aacagtaagttgaaggaggaccgagagatggtgttgtaccccagtaaaaacggcaccgta
gcggacctgttggaggaggcggggaaacaactacagctgccgcaggacgggggatcgggc
aagctcaggttactagaggtcattagcaacaagatcttctgcgtgcagaaggaagacgtc
ttgctggagtgtctgaacagccagggaaccaagacgtaccgcatcgaggagattcctcag
gaggagctcagcatccgggaggaggagctactcatccactgtgcacacttctccaaggag
gtgtttgcgacgttcggtacgcccttcatggtgaagatccgccagggcgagagcttcgcg
gcaatccgcgggcagatccagaagaagctggacgtcccggacaaggagttcgagaagtac
cagttcgccatcatcgtgatgggccgccagacctacattcctgaggagtactctgtcgag
ctgaaggacttcctgccccagatggtccccgggggcgccatgcagcccaaaccctggctc
ggcatcgaccacatcaacaaaacagccaagagatcgcggccgtacatgtacacagagaaa
gccatcaagatccacaattga

DBGET integrated database retrieval system