KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_265613Help
Entry
BRAFLDRAFT_265613 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:bfo03013]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:bfo04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 225 aa AA seqDB search
MNNKFEALKDDDSGEDKDEDKDENGESRRQQSPRPIQKAGPGEHPLQFNYSIWFSRRSPG
KQQNSTNYEQNIKLVGTFASVEQFWRFYSHMVRPGDLSGHSDFHLFKEGIKPMWEDEANK
DGGKWIVRLRKGLASRCWENLILAMLGEQFMVGEEICGAVISIRFQEDIVSVWNKTASDH
ATTTRIRDTLRRVLNLPPNTIMEYKAHQDSLKDNSSFRNTDVFMR
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaaattcgaagcgttgaaagatgatgacagcggagaagataaagatgaggac
aaggatgagaatggggagagtagaagacaacaaagccccagaccaatccagaaggctggc
ccaggagaacacccactccagttcaactattccatatggttctcaagacggtcgcctggg
aaacagcagaactccacaaactatgaacagaatattaaactagtcgggacttttgcctcg
gtggagcagttttggaggttctacagccacatggttcgaccaggagacctgtcaggacac
agcgacttccatctcttcaaggaagggatcaagcctatgtgggaggatgaagctaataaa
gatggtggaaagtggattgttcgtctacggaagggcctggcctcgcgctgctgggagaac
ctgatccttgccatgctgggggaacagttcatggtgggggaggagatctgtggggcagtc
atctccatacgcttccaggaggatatcgtttctgtgtggaacaagacagcctcagaccat
gcaacaacaacgcgtattcgggacaccctgcgccgggtgttgaaccttcctccaaacact
ataatggagtacaaggcccatcaagacagcctaaaggacaactccagcttccgtaacact
gatgtgttcatgagatga

DBGET integrated database retrieval system