KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_265613Help
Entry
BRAFLDRAFT_265613 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K03259  translation initiation factor 4E
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo03013  RNA transport
bfo04150  mTOR signaling pathway
Module
bfo_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    BRAFLDRAFT_265613
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    BRAFLDRAFT_265613
Messenger RNA biogenesis [BR:bfo03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     BRAFLDRAFT_265613
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     BRAFLDRAFT_265613
Translation factors [BR:bfo03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    BRAFLDRAFT_265613
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 7227280
NCBI-ProteinID: XP_002603471
JGI: 265613
UniProt: C3YK25
AA seq 225 aa AA seqDB search
MNNKFEALKDDDSGEDKDEDKDENGESRRQQSPRPIQKAGPGEHPLQFNYSIWFSRRSPG
KQQNSTNYEQNIKLVGTFASVEQFWRFYSHMVRPGDLSGHSDFHLFKEGIKPMWEDEANK
DGGKWIVRLRKGLASRCWENLILAMLGEQFMVGEEICGAVISIRFQEDIVSVWNKTASDH
ATTTRIRDTLRRVLNLPPNTIMEYKAHQDSLKDNSSFRNTDVFMR
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaaattcgaagcgttgaaagatgatgacagcggagaagataaagatgaggac
aaggatgagaatggggagagtagaagacaacaaagccccagaccaatccagaaggctggc
ccaggagaacacccactccagttcaactattccatatggttctcaagacggtcgcctggg
aaacagcagaactccacaaactatgaacagaatattaaactagtcgggacttttgcctcg
gtggagcagttttggaggttctacagccacatggttcgaccaggagacctgtcaggacac
agcgacttccatctcttcaaggaagggatcaagcctatgtgggaggatgaagctaataaa
gatggtggaaagtggattgttcgtctacggaagggcctggcctcgcgctgctgggagaac
ctgatccttgccatgctgggggaacagttcatggtgggggaggagatctgtggggcagtc
atctccatacgcttccaggaggatatcgtttctgtgtggaacaagacagcctcagaccat
gcaacaacaacgcgtattcgggacaccctgcgccgggtgttgaaccttcctccaaacact
ataatggagtacaaggcccatcaagacagcctaaaggacaactccagcttccgtaacact
gatgtgttcatgagatga

DBGET integrated database retrieval system