KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_268308Help
Entry
BRAFLDRAFT_268308 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BRAFLDRAFT_268308
   00670 One carbon pool by folate
    BRAFLDRAFT_268308
Enzymes [BR:bfo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BRAFLDRAFT_268308
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 185 aa AA seqDB search
MKTKKLSLVVAACNNMGIGVDGKIPWTLRGDMKFFSRLTSGTEEAGKQNAVVMGRKTWFS
IPDRFRPLPKRLNVVLSRNLTTPPEGAHHLAGSLEEAVKMLTETTVADTIDKVFIIGGNS
VYKDALSHPCCHRVYLTRVYKDVHCDTFFPNMDDTFKLVSDPTIPSEMQEENGIEYKYEV
YEKVA
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaagactaagaagctaagcctcgtcgtggctgcgtgcaacaacatgggcatcggtgtg
gacggcaagataccctggacactcaggggagacatgaagttcttcagcagactcacatca
gggacagaggaagcagggaagcagaatgcagtggtgatgggtaggaagacttggttctcc
atacctgatcgcttcaggcctctccccaagagactcaatgttgtcttgagtcgcaatctc
acaacaccaccagagggcgcccatcacctagcaggcagtctggaggaagcagtgaagatg
ttgactgaaacaacagtggcagatactattgacaaagtcttcatcattggaggaaattca
gtgtacaaggatgccctgagtcatccctgctgtcacagagtttacctaacgagggtatac
aaggacgtccactgtgatacattcttccccaacatggacgatacctttaaacttgtcagt
gaccccacaataccttcggagatgcaagaagaaaatggcatcgaatataagtatgaggtg
tatgaaaaggttgcatga

DBGET integrated database retrieval system