KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_270056Help
Entry
BRAFLDRAFT_270056 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BRAFLDRAFT_270056
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BRAFLDRAFT_270056
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BRAFLDRAFT_270056
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BRAFLDRAFT_270056
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     BRAFLDRAFT_270056
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 388 aa AA seqDB search
MSSVVVVTRQLFRVQRIFHHLRMSSTAATQPEVLLEKQKNVGVITLNRPKALNALNLNMI
RQIYPKLKEWEDNDDTTMIIIKGAGDKAFCAGGDIRAVTEAGKTGDRLAADFFREEYILN
NAIGTCPIPYIAFIDGITMGGGVGLSVHGLYRVATERTLFAMPETAIGLFPDVGGGYFLP
RLGGSLGMYLALTGYRLKGREVYKAGVATHYVESDKLPALEEELMSLKQSSSQKIDELLT
KYHKETKREMPEVPEFSLEPHMDKINNLFSPDSVEEIFEALMEDGSEWAMQQLEKLKKMS
PTSMKITHRQLSMGGHLSLQECLQIEYRMSQGCVRGHDFYEGVRAVLVDKDHSPKWNPST
LEGVTPRMLDSYFEPIPLSYLPAKELHL
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctgtcgtcgttgtaaccaggcaattgtttcgtgtacagaggatattccatcat
ctgagaatgtcctccacagctgccacacagccagaagtcctgttggagaaacagaagaat
gttggagtcatcaccctgaaccggcccaaggccctgaacgcactcaacctcaacatgatc
agacagatataccccaaacttaaggagtgggaagataatgacgacacaaccatgatcatc
ataaaaggtgctggagacaaagccttctgtgctgggggtgatatcagagctgtgacagaa
gctgggaagactggagatcgacttgctgcagactttttccgggaggagtacatccttaac
aatgcaatcggcacctgtcctataccttacatagcctttatcgatgggatcactatggga
gggggtgtcggattgtctgtccatggtttatatcgtgttgctacagagaggacgttattt
gccatgcctgaaactgctataggtctgttccctgatgtaggcggtggttacttcctgccc
aggctaggcggttccctggggatgtacctggctctgaccggatacaggttaaagggcagg
gaagtctacaaggccggcgtggccacacattatgtggagtcagacaagctgccagcatta
gaagaggaactgatgtccctgaaacagtcctcctcccagaagattgacgaactgctgaca
aaatatcataaagagaccaagagggagatgcccgaagtgcctgagttttctctggaacct
cacatggacaaaatcaacaacctgttttccccagacagtgtagaggagatctttgaggca
ctgatggaggatgggtcagagtgggctatgcagcagttggagaaactgaagaagatgtcc
cccacatctatgaagatcacccatcggcagctgtccatgggaggccacctgagcctacag
gagtgtctgcagatagagtacaggatgagccaaggatgtgtgagagggcacgatttttac
gagggagtcagagccgttcttgtggacaaagatcactcgcccaagtggaatcccagcacc
ttggaaggggtgacgccgaggatgttggattcgtacttcgagcccataccgctctcctat
ctgcccgccaaggaactgcacctctaa

DBGET integrated database retrieval system