KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_275043Help
Entry
BRAFLDRAFT_275043 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    BRAFLDRAFT_275043
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BRAFLDRAFT_275043
Enzymes [BR:bfo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BRAFLDRAFT_275043
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 192 aa AA seqDB search
MAAGQANFLLALLLSLASSAISQDDFYSFTAKDIKGKTVLLDKYRGKVSLVVNVASECGY
TDGHYRELVRLQDHLAPTKHFNVLAFPCNQFGGQEPMGNSAIAQFAKSMYKANFPMFSKI
DVVGREAHPAYKYLAESTQAPPTWNFWKYLVDPNGKVITAWPPHNAVVDIWSKVESAVNR
ARWDKGQRSTEL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgggacaggcaaactttctcctggcacttttactttctcttgcgtcttcggcc
atttctcaagacgacttctactccttcacggctaaggacatcaaggggaagacggtccta
ctagataagtatcggggaaaggtctccttagtcgtcaacgttgccagcgaatgcggatac
acagatggtcactacagggagttagtccgcctccaagaccacctagcacccaccaaacat
ttcaacgtgttggccttcccatgtaaccagttcggaggacaggaacctatggggaactca
gcgatcgcccagtttgccaagtccatgtataaagccaacttccccatgttttccaaaatt
gatgttgtaggaagagaagctcatccggcatacaaatacttggcagaatcaacgcaagcc
cctccgacctggaacttctggaagtacttggtggatccgaatggaaaagtcatcaccgct
tggccgccacacaacgccgtcgtggatatctggtcaaaggtagagagcgccgtgaaccgt
gccagatgggacaaagggcaacgatctactgaactttaa

DBGET integrated database retrieval system