KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_275769Help
Entry
BRAFLDRAFT_275769 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K03099  
son of sevenless
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
FoxO signaling pathway
Dorso-ventral axis formation
Jak-STAT signaling pathway
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:bfo04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:bfo04068]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:bfo04320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1222 aa AA seqDB search
MYSAAGAITDALTYDFDSEENAPKWHGLIVPALRKVQQQVHPHLTARDDALEYIEGLILQ
LLGMLCSCHPHTVQDVEERVQRTFPHPIDKWAIGDAQSALDRYKKKSPLVLPHDKIHPLL
KEVLGYTVDKQVSLYVVAVLEYISADILKLAGNYVKNIRHREMSCQDIKVAMCADKVLMD
MFHQDEDMSLSNVEEEPPPIRRGSLSFEEQVKELIMEETQYIRDLNMIIKVFRDPMAVNS
KLFSEQDLDQIFSNILDVHELSITFLGLLEDTMEMTDENNPAAAAGGCFEEMAESAEFDV
YLTYAQDMMSPASRQRHSQVLIKPKVALFFQSVSQGFKEAVQYVLPKLLLEPIYHCLHYF
EVIKLLLKTCPDEEDKESLEQAHGTLRPLQLQLERICEGKLPKRKPGDYSIRFQRRPGNR
SSLAKLNEIQKSIDGWEGKDIGQSCNEFIMDGQLGMFSKNRTTDRHVFLFDGLILACKPN
QRRSVTGNATEYRLKETFFMRKIVINDKEDSDELKHAFEIVARDQPNTIFFAKNEDEKNN
WMAALITLHCRSTLERMLDSILLEEEKKQPLRLPDESQYRFAMEDRPDNIVFEDNQQSLV
GVPVIKGGSLIKLIERLTYHMYADPTFVRTFLTTYRSISKPCELLDLLIERFEIPDPPPT
PEDQAAIDRGEVVVREDLKRFRKEYAQPVQLRVLNVFRHWVDHHFYDFERDKELLDKLME
FIEGVKGKTMRKWVDSITKIVLRQVGATSCENVPREITFERTPPSIEWYIARTPDQFELL
TLHPIEIARQLTLLEFDLYRAVKPSELVGSVWTKKDKHKTSPNLLKMIHHSTCLTRWMER
CIVEARNIDERVAMLSRVIEILMVFQELNNFNGVLEIVSALESAAVHRLEHTFKQVSERK
LAALDAAKELNADHYKKYTEKLRSINPPCVPFFGMYLTNILKTEEGNPDFLPNYPDGIIN
FSKRRKVAEITGEIQQYQNQPYCLTVEQDIRRFFENLDPLEGRTEHEFEDYLYKQSLEIE
PRNAKQPPKYQRKTDYPLKTPGIKPSSSRHMSVSGTLRGGNLVPLDKEPRSFRYHEVHDD
DAGGSTTPHVNTPPSPRTPLTPPSNTGFDHSVFASVQIPPTGPAQSLNSVFAPVLITPGR
THSHPSSATKHPRQADSDNASPPPLPPRTRKRDSSREEPPMTPRGIPQSSDAPELPPRTP
LPVPDLPPRTPVAVPDHRPPLP
NT seq 3666 nt NT seq  +upstreamnt  +downstreamnt
atgtattccgcggccggagcaatcaccgacgctctgacgtatgactttgacagcgaggag
aacgcgcccaaatggcacgggctgatcgtgcctgcccttcgcaaggtgcagcagcaggtg
cacccccacctgacggcacgtgacgatgctctggagtacatcgagggtttgatcctgcag
ctgctggggatgctgtgctcctgtcatcctcacacggtccaggatgtggaggagagggtc
cagcgcacctttcctcatcccatcgacaagtgggccatcggtgatgcacagtcagcactg
gacaggtacaagaagaagtcaccactcgtattgcctcatgacaaaatccacccactgctc
aaggaggtgctggggtacacggtagacaagcaggtgtccctgtacgtcgtggctgtgctg
gagtacatctctgctgatattctaaagttggcaggtaactatgtgaagaacatccgccac
agggaaatgtcatgtcaggacatcaaggtggccatgtgtgctgacaaggttctgatggac
atgttccaccaagatgaggacatgagcctgtccaacgtggaggaggaaccaccgcccatc
cgcagggggtccctgtcgtttgaggagcaggtgaaggaactgatcatggaggagactcag
tacatcagggacctcaacatgatcatcaaggtcttcagggatcccatggctgtcaactcc
aaactcttctcagagcaggatctggatcagatcttcagtaacatccttgacgtccatgag
ctgtccatcaccttcctggggctgctggaggacaccatggagatgacagatgagaacaac
cctgctgctgcggcaggaggctgcttcgaggagatggcagagtctgcagagttcgatgtg
tacctgacctatgcccaggacatgatgagtccggccagcagacagaggcacagtcaagtc
ctgatcaaacctaaagttgccctgttttttcagtctgtaagtcaaggctttaaggaggct
gttcagtatgtcctgcccaagctgctgctagaacccatctaccattgtctgcactacttt
gaggttataaagctactattgaagacctgtccagacgaggaggataaagaaagcctggaa
caggcacacggtacactcagaccacttcagctgcaactagaaagaatatgtgaagggaag
ttgccaaaaagaaaaccaggggactactccatcagattccagagaaggccggggaataga
tcgtcactagccaaactgaatgagattcagaagagcattgatgggtgggagggcaaagac
atagggcaaagctgcaatgagttcatcatggatggacaactaggaatgtttagcaagaac
aggacaacagacagacatgtgttcctgttcgacggcctgattctggcgtgcaagccgaac
cagcgccgttcagtgacgggcaacgccacggagtaccggttaaaggagaccttcttcatg
aggaaaatagtcatcaatgacaaggaggacagcgatgaactaaaacatgcctttgagatt
gtggccagagaccagccaaacacaatcttctttgccaaaaacgaggatgagaagaacaac
tggatggctgcactcatcactctgcactgtagaagtacgctggagagaatgttggacagc
atactcctggaggaagaaaagaaacaacccttaagattaccagacgagtctcagtacagg
tttgccatggaagaccggccagacaacattgtgtttgaggacaatcagcagtccctggtg
ggggtccctgtcatcaagggcggctcactcatcaagctcatagaaagactcacatatcac
atgtatgcagatcctacctttgtcagaacgttcctgacgacgtaccggtccataagcaag
ccgtgtgagctgctagacctccttatagaaagatttgagatccccgacccccctcccacc
ccagaagaccaggctgctatcgacagaggagaagtggttgtccgagaggacctgaagagg
tttcggaaagagtatgctcaacctgtgcaactcagggttctgaacgtgttccgccactgg
gtagaccaccacttctacgactttgagcgggacaaagagctgttggacaaactgatggag
ttcatcgagggagtcaagggcaagaccatgaggaaatgggtggactccatcactaagata
gtgctgcgacaggtgggtgctacatcatgtgaaaatgtacccagggaaattacttttgaa
agaaccccgccctccatagaatggtatatagcaaggacgcctgaccagtttgagctactc
actctccatccaatagaaattgccagacagttgacgttacttgagtttgatttgtacaga
gctgtgaagccgtccgagttggtaggaagtgtctggaccaagaaagacaagcacaagaca
tcacccaacttactcaagatgatccatcactccacatgtttaactagatggatggagagg
tgcatcgtggaagctcgcaacattgatgaaagggtggccatgctgtccagagttatagaa
atccttatggtgttccaggagctgaacaattttaacggagtcctggagattgtgagcgcc
cttgaatcagctgctgtacacaggctggaacacacctttaagcaagtgtctgagaggaag
ctggctgccttggatgctgccaaggagttaaatgctgatcactacaagaagtacacggag
aagcttcgttccatcaacccaccatgtgtgcctttttttggcatgtacttgactaacata
cttaagacggaagaaggcaacccggacttcctcccaaactaccctgatgggatcatcaac
ttcagcaagagaagaaaagtggctgagatcacaggggagatccagcaataccagaaccaa
ccctactgtctaactgtggagcaggacatcaggagattctttgagaatctggatcccctt
gaaggaaggacggagcatgagtttgaagattacctgtacaagcagtcccttgagattgag
cccagaaacgctaagcagcccccgaaatatcaaaggaaaacagactaccctctaaaaacc
ccgggaatcaagcccagctcctcccggcacatgtccgtgtccggtaccctgcgcggcgga
aacctggtccctctggacaaggagcccagatccttccgctaccacgaggtccacgacgat
gacgcgggagggtccaccacgccgcacgtcaacacccccccgtccccacgcacgcccctg
actccgccctccaacactggctttgaccacagcgtgttcgcctcggtacagatcccgcca
acaggaccagctcaaagtctaaacagtgtgtttgctcctgtactgatcacgccaggtagg
acccactcccatccctcctccgcaacaaaacacccccgccaagctgattctgacaatgcc
agtcctccgccactgcctccaaggacaagaaaacgggactcatcgcgcgaagaaccgccc
atgactcctcgaggaattccacaatcctcggacgcccccgagttgccccctaggactccc
ttaccagtgcctgacctcccacccagaactcctgtcgctgtgcctgatcacaggccgcct
ctgccc

DBGET integrated database retrieval system