KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_276374Help
Entry
BRAFLDRAFT_276374 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00062  Fatty acid elongation
bfo01100  Metabolic pathways
bfo01212  Fatty acid metabolism
bfo04142  Lysosome
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    BRAFLDRAFT_276374
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    BRAFLDRAFT_276374
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     BRAFLDRAFT_276374
Lipid biosynthesis proteins [BR:bfo01004]
 Fatty acid synthase
  Component type
   BRAFLDRAFT_276374
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Palm_thioest DUF676 Lipase_2 PGAP1 Hydrolase_4 Abhydrolase_1 6PGD PPO1_DWL
Motif
Other DBs
NCBI-GeneID: 7226541
NCBI-ProteinID: XP_002600133
JGI: 276374
UniProt: C3YTL8
AA seq 298 aa AA seqDB search
MAAGCVKVFPKFVLSSFLVLLSALLVQIRAYKPIIIIHGIFDHASTFDNFSVAIKKAHPG
TNVTIIDEYTELFSLYPMWEQVRGFQKTMAPIMQQAKDGVHIICYSQGGLICRGVLESMD
DHNVDTFISLSSPLMGQYGDTEYLKYVFPHYLKENLYKVAYTSYGQDISISNYWNDPHHQ
DLYKENSVFLAVLNNQTAKNDKSKEYKNNFLKLKKLVLIGGPDDGVITPWQSSHFGFYDD
NETVVEMKEQEVYQRDYFGLKTMDARGDVTTYEIPGVQHLNWHKNLTVFNDYIEKWLT
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggggtgcgtaaaagttttccccaaattcgtcctttcgtcgttcctggtgctt
ctctccgcgttactggtccaaatcagggcctacaagcccataatcatcatacacggcata
ttcgatcacgccagtacctttgacaacttcagcgtcgcgatcaaaaaggcccaccctggc
accaatgtgaccatcatcgatgagtacacagaactgttcagcctctatcccatgtgggag
caggtcagggggtttcagaagaccatggctcccatcatgcaacaggccaaggatggggtg
cacattatctgctattctcagggtggccttatatgtcgaggtgttctagagtcgatggac
gaccacaacgtggacacctttatttcactgtcttctccactcatggggcaatatggagac
acagagtacctgaagtatgtgtttccccactatctgaaggagaacctgtataaagtagcc
tatacttcctatggacaggacatctccatcagtaactactggaacgacccccaccaccag
gacctctacaaggagaacagtgttttcctcgctgttttaaacaaccagacggccaaaaat
gacaaaagtaaagaatacaagaataacttcctcaagctgaagaaactggtgctgattgga
gggccagatgatggtgtcattaccccctggcagtccagccactttggtttctatgatgac
aatgagacagtggtggagatgaaagaacaggaggtgtaccagagggactactttgggctg
aagaccatggatgcgaggggagatgtcacgacgtacgagatccctggggttcaacatctc
aattggcacaaaaatctcacagttttcaacgactacatcgaaaagtggcttacttga

DBGET integrated database retrieval system