KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_276561Help
Entry
BRAFLDRAFT_276561 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00730  Thiamine metabolism
bfo00790  Folate biosynthesis
bfo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BRAFLDRAFT_276561
   00790 Folate biosynthesis
    BRAFLDRAFT_276561
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BRAFLDRAFT_276561
Exosome [BR:bfo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BRAFLDRAFT_276561
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bfo00537]
 Enzymes
  BRAFLDRAFT_276561
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Chlorovi_GP_rpt
Motif
Other DBs
NCBI-GeneID: 7221612
NCBI-ProteinID: XP_002598338
JGI: 276561
UniProt: C3YZS9
AA seq 492 aa AA seqDB search
MYVSFQSEAQGRTPHQELDPAFWDDMAHRDLDRAIQLQKLNLNIAKNVVLFIGDGMGLTT
VTTGRILKGQLQGQPGEETVLAMDSLPHVGLVKTYSLDYQVPDSAGTATAFLSGVKAARG
TIGVNGRVQHGVCATQKGNEVNSILVLANQAGKSTGVVSTSSLTDATVASTYAHSASRYW
DTDANLPWEAIYKGCKDIAAQLVDSAPDIEVLLAGGRQNFLPRSVADMEYPNKFGTRRDG
RNLVEEWITRKPGTARFVWNLDEFNAIDSNRTDYLLGLFEPHHMKFSVDRDLDGAGEPTL
SDMTRKAIQILQKNSNGFFLLVEGGRIDHGHHANQAVRALHDTVAFDDAIQVAKDMLDMQ
DSLIIVTADHSHTFNFGGYPSRGHPIFRKTDYNFGFELLDRKPMTSLLYGNGPGYSLSGT
RQDITNVNTGRKDYKQQSAVPLAHETHGGEDVPIFAGGPMAHLFHGVCEQNYIAHVMKYA
ACLGEYHENCHS
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgtacgtgtcatttcaatcagaggcccagggacgcacacctcatcaggaactagatcca
gcattctgggatgacatggcacatcgcgaccttgacagagccattcagctccagaagttg
aacttgaacatcgccaagaatgtggtactgtttataggggatggcatgggtttaaccact
gtgaccacggggaggattctgaagggacagttacaaggccagccgggggaggaaactgtg
ctggctatggactcactgccacatgtgggactggtcaagacctacagcctggactaccag
gtcccagactctgcagggacggccacagctttcctgtcaggggtgaaggcagcgagaggg
accataggggtcaacggtcgggtacagcatggtgtctgtgcaactcagaagggtaacgag
gtcaactccatcctggtgttggccaatcaggcaggcaagtcgaccggagttgtgtccacc
tccagccttacagatgccacagtagcctccacctatgcccacagtgccagccgatactgg
gacacggatgctaacctgccctgggaggccatctacaaggggtgcaaggacattgcagct
cagctggtggatagtgcacctgacatagaagtgcttctagcaggtggacgtcaaaacttc
cttcctcgaagcgttgccgacatggagtatcctaacaagtttggaactcgtcgagacggc
aggaaccttgttgaagaatggatcaccagaaaaccagggaccgcccggtttgtttggaac
ctggatgagttcaatgccattgattcaaacaggacagactatcttttggggctgtttgag
cctcaccacatgaagttttccgttgaccgtgaccttgatggtgcaggcgagccaacccta
tctgacatgactcgaaaagccatccaaatcctacagaagaacagcaatggtttctttctg
cttgtggaaggtgggcgcattgaccatggacaccacgcaaaccaagctgtcagggcattg
catgacacagtggcatttgatgatgccattcaggttgccaaagacatgttggacatgcag
gacagtctgatcatagtgacagctgaccattcccacaccttcaactttggagggtatcca
agtcgagggcaccccatatttcgaaagactgactacaactttggttttgaacttcttgac
cggaagccgatgacgagtctgctgtatggcaacgggccaggctacagtctgtctggcaca
cggcaggacatcaccaatgtcaacacaggaagaaaagactacaaacagcagagtgcagtg
cctctggcccatgagacgcatggcggagaggatgtacccatctttgctgggggtcccatg
gcgcatctgttccatggtgtttgcgaacagaactacattgcacacgtcatgaagtatgca
gcatgcctcggagagtaccacgaaaactgtcacagt

DBGET integrated database retrieval system