KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_276561Help
Entry
BRAFLDRAFT_276561 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bfo00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 492 aa AA seqDB search
MYVSFQSEAQGRTPHQELDPAFWDDMAHRDLDRAIQLQKLNLNIAKNVVLFIGDGMGLTT
VTTGRILKGQLQGQPGEETVLAMDSLPHVGLVKTYSLDYQVPDSAGTATAFLSGVKAARG
TIGVNGRVQHGVCATQKGNEVNSILVLANQAGKSTGVVSTSSLTDATVASTYAHSASRYW
DTDANLPWEAIYKGCKDIAAQLVDSAPDIEVLLAGGRQNFLPRSVADMEYPNKFGTRRDG
RNLVEEWITRKPGTARFVWNLDEFNAIDSNRTDYLLGLFEPHHMKFSVDRDLDGAGEPTL
SDMTRKAIQILQKNSNGFFLLVEGGRIDHGHHANQAVRALHDTVAFDDAIQVAKDMLDMQ
DSLIIVTADHSHTFNFGGYPSRGHPIFRKTDYNFGFELLDRKPMTSLLYGNGPGYSLSGT
RQDITNVNTGRKDYKQQSAVPLAHETHGGEDVPIFAGGPMAHLFHGVCEQNYIAHVMKYA
ACLGEYHENCHS
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgtacgtgtcatttcaatcagaggcccagggacgcacacctcatcaggaactagatcca
gcattctgggatgacatggcacatcgcgaccttgacagagccattcagctccagaagttg
aacttgaacatcgccaagaatgtggtactgtttataggggatggcatgggtttaaccact
gtgaccacggggaggattctgaagggacagttacaaggccagccgggggaggaaactgtg
ctggctatggactcactgccacatgtgggactggtcaagacctacagcctggactaccag
gtcccagactctgcagggacggccacagctttcctgtcaggggtgaaggcagcgagaggg
accataggggtcaacggtcgggtacagcatggtgtctgtgcaactcagaagggtaacgag
gtcaactccatcctggtgttggccaatcaggcaggcaagtcgaccggagttgtgtccacc
tccagccttacagatgccacagtagcctccacctatgcccacagtgccagccgatactgg
gacacggatgctaacctgccctgggaggccatctacaaggggtgcaaggacattgcagct
cagctggtggatagtgcacctgacatagaagtgcttctagcaggtggacgtcaaaacttc
cttcctcgaagcgttgccgacatggagtatcctaacaagtttggaactcgtcgagacggc
aggaaccttgttgaagaatggatcaccagaaaaccagggaccgcccggtttgtttggaac
ctggatgagttcaatgccattgattcaaacaggacagactatcttttggggctgtttgag
cctcaccacatgaagttttccgttgaccgtgaccttgatggtgcaggcgagccaacccta
tctgacatgactcgaaaagccatccaaatcctacagaagaacagcaatggtttctttctg
cttgtggaaggtgggcgcattgaccatggacaccacgcaaaccaagctgtcagggcattg
catgacacagtggcatttgatgatgccattcaggttgccaaagacatgttggacatgcag
gacagtctgatcatagtgacagctgaccattcccacaccttcaactttggagggtatcca
agtcgagggcaccccatatttcgaaagactgactacaactttggttttgaacttcttgac
cggaagccgatgacgagtctgctgtatggcaacgggccaggctacagtctgtctggcaca
cggcaggacatcaccaatgtcaacacaggaagaaaagactacaaacagcagagtgcagtg
cctctggcccatgagacgcatggcggagaggatgtacccatctttgctgggggtcccatg
gcgcatctgttccatggtgtttgcgaacagaactacattgcacacgtcatgaagtatgca
gcatgcctcggagagtaccacgaaaactgtcacagt

DBGET integrated database retrieval system