KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_277144Help
Entry
BRAFLDRAFT_277144 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BRAFLDRAFT_277144
  Energy metabolism
   00920 Sulfur metabolism
    BRAFLDRAFT_277144
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    BRAFLDRAFT_277144
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     BRAFLDRAFT_277144
    3.1.3.25  inositol-phosphate phosphatase
     BRAFLDRAFT_277144
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 357 aa AA seqDB search
MAPMGVRLSPLGYALIFILIGSVVLYLQVWMRGSSDKKNPKLTLGEDGDVHSMSVDISLK
ELLAVSIDLAEKGGDKVREIREANKLAEKSKGETREGANDPMTDGDLQSHIAIVHGFEKV
FPRLKVVSEEHEKKGDETRQVATPKLTHPEVDEVIKADQRVPYEDVTVWVDPLDATQEYT
EDLRQYVTTMVCVAIKGKPTIGVIHKPFEHRTAWAWVGHGHSKGLNVQERKAGEGQAQKI
IVSRSHAGSVEQVAKQMLGDKTEVIPAGGAGYKVLSLFEGIADAYIHVTLIKKWDICAGN
ALLNTVNGHMTTLGGDDINYSAEGNPKNEGGLLATLVDHQKFLEKFAPEAKKLAEKH
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaatgggagtgcgcctgtccccgctggggtatgccctgatattcatactcatc
ggcagtgtggttctgtacctgcaagtgtggatgcggggctcgagcgacaagaagaacccc
aagctgactctgggggaagacggggacgtgcactccatgagcgtggacataagcctgaag
gagctgcttgcagtcagcattgacttagcagagaagggaggggacaaggtgagagagatc
agagaggcaaacaaactggcggagaagagcaagggggagacaagggagggcgcgaacgac
ccgatgacggacggtgacctccagtcccacatcgcgatcgtgcacgggttcgagaaggtg
ttcccgcgcctcaaggtggtgtccgaggagcacgagaagaaaggggacgagacgcgccag
gtcgcgaccccgaaactgacccaccctgaggtggacgaggtcatcaaggccgaccagagg
gtcccctacgaggacgtgacagtgtgggtggaccctctggatgccacgcaggagtacacg
gaagacctgcgtcagtacgtgaccaccatggtgtgcgtggccatcaaggggaagccgacc
atcggtgtgatccacaagccgttcgagcacaggacagcatgggcctgggtggggcacggt
cactccaaggggctcaacgtccaggagaggaaagccggggaggggcaggcgcagaagatc
atcgtgtcgcggtcgcacgcgggttcggtggagcaggtagccaagcagatgcttggcgac
aagacggaggtcataccggcgggtggagccggctataaagtcctctcgcttttcgagggg
atcgcggacgcgtacattcacgtgaccctgataaagaagtgggacatctgcgcggggaac
gctctactgaacacggtgaacggacacatgacgacgctgggtggggatgacattaattac
tccgccgaggggaaccccaagaacgagggagggctgctagcgaccctcgtcgaccaccag
aagtttctcgagaagtttgcgcccgaagccaagaagctagcagaaaaacactag

DBGET integrated database retrieval system