KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_277479Help
Entry
BRAFLDRAFT_277479 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    BRAFLDRAFT_277479
   03008 Ribosome biogenesis in eukaryotes
    BRAFLDRAFT_277479
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     BRAFLDRAFT_277479
Ribosome biogenesis [BR:bfo03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     BRAFLDRAFT_277479
Transfer RNA biogenesis [BR:bfo03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    BRAFLDRAFT_277479
Mitochondrial biogenesis [BR:bfo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    BRAFLDRAFT_277479
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 93 aa AA seqDB search
MQSNFKGQLERAQRMLDAGSNEVFIHGLGHAINRAINIALQLKARGLGTIEVSTNTSTVE
LIDDLYPEKDDVSSEVQSRNNSAVHIRVFRLSS
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atgcagtccaacttcaagggccagttggagagagctcagaggatgctggatgcaggctcc
aatgaagtcttcatccatggacttggccatgccatcaatcgagccatcaacatagcgcta
cagcttaaggctagagggctggggacgattgaggtgtctaccaacacgtccacagtggaa
ctgatcgatgacttgtatccggaaaaagacgacgtgtcatctgaggttcagtcaaggaac
aattcagctgttcacatcagggtcttcagactcagttcctga

DBGET integrated database retrieval system