KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_277757Help
Entry
BRAFLDRAFT_277757 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 573 aa AA seqDB search
MLKEAIQQNDFMKNLDPIQVSEIVDCMDFQMFQSGQKVIQEGEAGQQLFVAEVGDLQVTK
GGKYLGNMGPKTLFGELALLYNCSRTATVKAVTESKLWAIDRNIFQMIMIKTGRTRREEH
FKFLKSVSLLKELPHAKLSKIADCLEVDFYHEGEYIIREGQTGDTFFIIIEGEVKVTQKI
EGEEEPKLTRRLGRGETFGEKALLSEEKRTANVIAVGGVKCLTLDRVVFNQLIGQLSEIK
KVDEHDQVNGPAQEQLMYAKVPLDDLDIVATLGVGGFGRVELVKWQDKSFALKCLKKKHI
VNTRQQEHIYSEKAIMMSCNSPFITKLFKTFKDTRYVYMMMEPCLGGELWTILRDRGSFD
DHTTRFCTACVVQAFTYLHGRGIIYRDLKPENLLLDQRGYVKLCDFGFAKKIGFGHKTWT
FCGTPEYVAPEIILNKGHDYSADVWSLGILMFELLTGTPPFSGSDPMKTYNLILKGIDAV
EFPRKIGKNANNLIKKLCKENPSERLGYQKNGMNDIKKHKWFQGFDWDGLTTQSTQPPIV
PKVRGPSDTSNFDKYSRETDIPPEEMSGWDTDF
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaggaagcgatccagcagaatgacttcatgaagaatctggacccgatccaggtc
agcgagatcgtggactgcatggacttccagatgttccagtccggacagaaggtcatccag
gagggcgaggccggccagcagctatttgtggcagaagttggtgacttgcaggtgacaaaa
ggagggaaatacctgggcaacatggggccaaagacactgttcggagagctggcactcctt
tataactgtagcagaacagccactgtcaaagctgttactgagtccaagctgtgggccata
gacaggaatattttccagatgatcatgatcaagacagggagaaccaggagggaagaacac
ttcaagtttctcaagagcgtctccctgttgaaagagctaccacatgccaaactgtccaag
atagccgactgccttgaagtggacttctaccatgaaggggagtacatcatcagagagggc
caaaccggagatactttcttcatcattattgagggggaggttaaggttacccagaaaata
gaaggagaggaggagccaaaactgaccagaagactgggacggggagaaacgtttggagag
aaagcacttctcagtgaagaaaaaagaaccgcaaacgtcatcgctgtaggaggggtgaaa
tgccttacgcttgacagagtagtcttcaaccagctgattggtcaacttagcgagattaag
aaggtggacgagcatgaccaggtgaacggcccagcacaggagcagctgatgtatgccaag
gttccactggatgatctggacatcgtggccactctgggtgtgggagggttcgggagggtc
gagctggtgaagtggcaggacaagtcgtttgccctgaagtgccttaagaagaaacacatc
gtcaacaccagacaacaggagcacatctactcggagaaggccattatgatgtcctgtaac
tcacccttcatcacaaagttgtttaagacatttaaggacaccaggtatgtgtacatgatg
atggagccgtgtctggggggagaactctggaccatattaagagacagaggttcgttcgac
gaccacacaacacggttctgcacagcatgcgtggttcaggccttcacgtacctgcacggc
agaggcatcatctacagggacctgaaacctgagaacctgctactggaccagaggggatac
gtcaaactgtgtgactttggctttgccaagaagatcggatttgggcacaagacgtggacg
ttctgcggcacgcctgagtatgtggcgccagagatcatcctgaacaaagggcacgactac
tctgctgacgtctggtcacttggtatcctcatgtttgagctgctcactggaacgccaccg
ttttccggctccgaccccatgaagacctacaacctgatcctgaagggcatcgatgctgtg
gagttccccagaaagatcggcaaaaacgccaacaatctcatcaagaagctatgcaaagag
aacccttcagagaggttgggctatcagaagaatggaatgaatgacatcaagaaacacaag
tggttccagggttttgactgggatggactcaccacacagtcaacacaacctcccattgtt
ccaaaggtgcgagggccaagtgacacaagtaacttcgataaatactcccgagagaccgac
atccctcccgaggagatgtctggatgggacacagacttctag

DBGET integrated database retrieval system