KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_278042Help
Entry
BRAFLDRAFT_278042 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K09186  
histone-lysine N-methyltransferase MLL1 [EC:2.1.1.43]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    BRAFLDRAFT_278042
Enzymes [BR:bfo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     BRAFLDRAFT_278042
Transcription factors [BR:bfo03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    BRAFLDRAFT_278042
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 313 aa AA seqDB search
MPKEDKPKLVFEITSDDGFKTTADTIDAAWDQVVEKVQEARINARMKQLSFAAVRGCVML
GVTHESVMNLIEQLAGAKNCIHYKFKYHKYSPHDLAEDEDPPVNPNGCCRAEVLSRRSKF
DMFSWLASQHRQLPVLDYNEEEEEVQHKSTRRPTSMDLPMAMRFRYLRQTSREAVGVYRS
PIHGRGLFCKRNIDSGEMVIEYAGMVIRSVLTDKRENYYNSKGIGCYMFRIDDYEVVDAT
MHGNAARFINHSCDPNCYSRVIQVEGKKHIVIFAMRKIYKGEELTYDYKFPIEDQNSKID
CTCGSKRCRKYLN
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaagaggacaaacctaagcttgtgtttgagatcaccagtgatgatggcttcaaa
acaactgcagacacaattgatgctgcctgggaccaggttgtggaaaaggtgcaggaggca
aggatcaatgctcgcatgaagcaactgtcctttgctgcagtgaggggttgtgtcatgctg
ggggtcacacatgagtctgtgatgaacctgattgaacagctggctggggccaagaactgt
attcactacaagttcaagtaccacaagtacagcccccatgacctggcagaggatgaggat
ccaccagtcaaccccaatgggtgctgcagagcagaagtcttgtctagacggtcaaagttt
gacatgttcagctggctggcctcacagcacagacagctccctgtcctggactacaatgag
gaggaggaagaggtccagcacaaatccaccaggagaccaaccagtatggaccttcccatg
gccatgagattccgctacctgcggcagacatcaagggaggctgtgggtgtataccgttca
cctatccatgggcggggcctcttctgtaaacgcaacatcgactctggggagatggtgatc
gaatatgctggcatggtcattcgctctgtcctcactgacaaaagagagaactactacaac
agcaaggggattggctgctacatgtttcgcattgatgactatgaagttgtggatgcaacc
atgcatgggaatgctgctcgcttcatcaaccattcttgtgatcccaactgttactcacga
gtcatccaagtggaaggcaagaagcacattgtcatctttgctatgaggaaaatatacaag
ggggaggaactgacctatgactacaagttccccattgaggaccagaactccaaaatagat
tgtacctgtggatctaagaggtgccgcaagtacctgaactga

DBGET integrated database retrieval system