KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_278128Help
Entry
BRAFLDRAFT_278128 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Exosome [BR:bfo04147]
 Exosomal proteins
  Proteins found in most exosomes
   BRAFLDRAFT_278128
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 126 aa AA seqDB search
MSWQQYVDQHLVATQCVTMAAICGLDGSIWAKSPGLELSQDEVSTMARAFTSNEVLVQNG
IRIGGTKYIYLSGDDKLIRGKKDRGGVHIVKTKTAMVMALYAEPILPEQCACVVEKLGDW
LIQNEL
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcaacagtatgtcgaccaacatttggtggcgacccagtgcgtgactatggct
gcgatttgtggcttggacggaagcatttgggctaaatcccccggcctcgagctgtcacaa
gacgaggtctcaacaatggcgagagccttcactagtaatgaagttttagttcaaaatgga
attagaataggaggaacaaagtacatctatctgagcggggacgataagctcatcaggggg
aagaaggacagaggaggtgttcacatagtgaaaactaaaacagctatggtgatggcactg
tacgcagagccgatcctgccagagcagtgcgcctgcgtggtagaaaaactgggagactgg
ctgattcagaacgagctttga

DBGET integrated database retrieval system