KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_278330Help
Entry
BRAFLDRAFT_278330 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K17610  
calcineurin B homologous protein 1
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Protein phosphatases and associated proteins [BR:bfo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     BRAFLDRAFT_278330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 192 aa AA seqDB search
MGSRASLLLRQEEIEEIQRETGFSHNQITRLYSRFTSLDKSQNGALSREDLLRIPELAIN
PLGERVVQLFFLEGEDEQVNFRQYMRTLARFRPLDPSQKNDKEGVNSREKKLEFAFRMYD
LDQDNRISRDEVLQVLRMMVGVNISEEQLGSIADRTILEADTDGDQRISFEEFCKAMERS
EVEQKMSVRFLD
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgggttcccgggcttctctgcttctcagacaggaagaaatcgaggaaatacagcgggaa
actgggttctcgcacaaccagatcacacgactgtacagtcggtttactagtcttgacaag
agtcagaatggggccctgagtcgagaggacttactgagaattcctgagctggccatcaat
ccccttggagaaagggttgtacagttattctttttagaaggggaggatgagcaggtgaac
tttcgccagtacatgcgaacgctggcacggttccgacccctggacccgagtcagaagaac
gataaagagggcgtcaatagcagggagaagaaactggagtttgctttcaggatgtatgac
ttggaccaagacaacaggatctccagagatgaagttttacaggttttgcggatgatggtt
ggggtgaacatctccgaggagcagctgggcagtatcgcagacagaaccattctagaggca
gacactgatggagaccagcgcatctcatttgaggagttttgcaaggccatggagagaagt
gaagtggaacagaagatgtcagtgaggtttttggactag

DBGET integrated database retrieval system