KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_279349Help
Entry
BRAFLDRAFT_279349 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K11405  
histone deacetylase 8 [EC:3.5.1.98]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     BRAFLDRAFT_279349
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 401 aa AA seqDB search
MADGSDKENDGMGCHRNLTPNRDVLAPRSDVVCRNDKVVFVHSQMYVDLCNNLAKVPGRA
SAVHGLIEAYGLTKELRLVEPRPATVAELTSFHSTDYIHHLRKASAEEDEEKDIDVSEEF
GLCYDCPILPGVYEYAAMVAGATLTAAQCLIDGECQVAINWHGGWHHAKKDEASGFCYVN
DPVLAILRLRERFSKVLYIDLDLHHGDGVEDAFCCTSRVMTLSLHKFDTGFFPGTGDIQD
TGMGRGRYYTVNVPLRDGIQDSQYFSVFNKVVSQTESSYRPEAVVLQLGADGMSGDPMGC
FNLTPQGLGRCLELVLDWKLPTLLLGGGGYHVGNTARCWTSLTAQVLGKSLPPDIPEHEH
FTEYGPDYELGISPGNRVNHNSDEYIEEVINTVSENLAHVM
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggcggacggcagtgacaaagaaaacgatggaatgggttgtcatcggaatcttactcca
aatcgggacgttttagcaccacgtagcgacgttgtttgtagaaatgataaggttgtgttt
gtacatagtcagatgtatgtagatttgtgcaataatctcgccaaagtaccaggaagggca
agtgcagttcatggactgatagaagcctatgggttgacaaaggaacttagacttgtagaa
ccccggccggccactgttgcagagctgacatcattccactctacagactacatccaccac
ctgaggaaggccagtgcagaggaggatgaggagaaagacattgatgtgtcagaggagttt
ggactttgctacgactgtcccatcctccctggggtgtatgagtatgctgccatggttgcc
ggggcaaccctgaccgcggcccaatgtttgatagatggagagtgtcaggttgccatcaac
tggcacggcggctggcaccatgctaaaaaagatgaggcatcaggtttctgctatgtgaat
gatcctgtactggctatcctgagactcagggaaaggttcagtaaagtgctgtacatagac
ctggacctacatcatggggatggtgtagaagatgctttctgttgtacatctcgagtcatg
actctctctctgcacaaatttgacactggattcttcccaggtacaggagatatccaagat
acagggatggggaggggcagatactacacagtcaacgtgccactcagagatgggattcag
gactctcagtacttcagtgtgtttaacaaagttgtgagccagactgagagcagctacaga
ccagaggctgtggtgttgcagctgggggcggacgggatgagtggggaccccatggggtgt
ttcaacctgaccccccagggattggggaggtgcctggaactggtgctggactggaaactc
ccaactcttctactgggtggtggtggttatcatgtaggaaacactgcgcgctgctggacc
tctctaacagcacaggttctgggcaagtctctacctccggacatacctgaacatgagcac
tttacagagtatggtccagactatgaactgggcatctcccccggcaaccgtgtcaatcac
aactcagatgagtacattgaggaggtgatcaacactgtttcagaaaacctggctcatgtg
atgtga

DBGET integrated database retrieval system