KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_279693Help
Entry
BRAFLDRAFT_279693 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00220  Arginine biosynthesis
bfo00330  Arginine and proline metabolism
bfo01100  Metabolic pathways
bfo01230  Biosynthesis of amino acids
Module
bfo_M00029  Urea cycle
bfo_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    BRAFLDRAFT_279693
   00330 Arginine and proline metabolism
    BRAFLDRAFT_279693
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BRAFLDRAFT_279693
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 7210128
NCBI-ProteinID: XP_002596448
JGI: 279693
UniProt: C3Z4T8
AA seq 347 aa AA seqDB search
MACRRTLQMCGSGLLRRFGRQQQLRHSRSYGRDVAIIGAPFKKGQRLAGVEQGPRVMREA
GLIEKIRELGHNVEDRGDLNFEVFKDDPKNYVLNPKAVGAATKKVSAAVEQAVRDNKLTV
TLGGDHSISIGTIHGHAQAEPNLCLLWIDAHADINTPLTTPSGNIHGTPLSFLVNQLKDT
IPWTALSPFDWLKPCLNITDIAFVGLRDLDPGERYILQKFNITSFSIHEVDRYGIHEVIA
RSLDAVNPKGDRPIHMSFDIDSVDPAVTGATGTPVPGGLTFREGMFIAEHVYRTGLLSAL
DLVEVNPEVGSRQDKANTVMTAVEVLTACLGKKREGNLQPGYQLPLP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggcgtgtagaagaacgttacagatgtgtgggtcgggactgttgaggagatttggccgc
cagcaacagctacgacactccagatcatacggcagggatgtcgccatcatcggcgcgcca
ttcaagaagggacagaggttggccggtgttgagcagggtcccagagtgatgagagaagca
ggattgattgagaaaatcagagaactcggccacaatgttgaagacagaggtgacctcaac
tttgaagtttttaaagacgacccaaagaactatgttctcaaccccaaagctgtgggcgct
gcaactaagaaggtatcagcagcagtggagcaggcagtacgggacaacaagttgacagtg
acgttgggaggggaccacagcatatccatcgggacgatccacggccacgcacaagcggag
cccaatctgtgtctcctttggatcgacgcccacgctgacatcaacaccccactcaccacg
ccgagcggcaacatccacggcacaccgctgtccttcctggtcaatcagctgaaagataca
attccgtggacagccttgtcaccatttgattggctgaaaccatgcctgaacatcacagac
attgcctttgtaggtctgcgtgacctggatccaggtgaacgctacattctgcaaaagttc
aacatcaccagtttctctatccatgaggtggacagatatggcatccatgaggttatcgcc
aggtcgttggatgctgttaacccaaaaggggaccgaccaatccacatgagtttcgacatc
gactctgttgatcctgccgtcactggtgccacaggaactcctgtaccgggtggtctgacc
ttccgagaggggatgttcattgctgagcatgtgtacaggacaggtctgctctcagccctt
gaccttgtagaggtcaacccagaggtcgggagtcggcaggacaaggccaatactgtcatg
acagcagtggaggttctgacagcgtgtttggggaagaagagggagggtaacctacagccg
gggtaccagctccccttgccttag

DBGET integrated database retrieval system