KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_280425Help
Entry
BRAFLDRAFT_280425 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00072  Synthesis and degradation of ketone bodies
bfo00650  Butanoate metabolism
bfo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BRAFLDRAFT_280425
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BRAFLDRAFT_280425
Enzymes [BR:bfo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     BRAFLDRAFT_280425
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Sacchrp_dh_NADP HHH_5
Motif
Other DBs
NCBI-GeneID: 7217335
NCBI-ProteinID: XP_002612563
JGI: 280425
UniProt: C3XTE6
AA seq 247 aa AA seqDB search
MGRLDGKVALCTASAQGIGLSTVLAFAKEGARVIATDVNISKLEQEVKDVPGIEAKTLNV
ADKDQVTALVDQLDRVDILFNCAGIVHNGTILDCEEADWDQTMNVNLKSMYFLCRAVLPK
MVAQGSGSIVSMSSSASSIKGVPMRFAYSVSKGGVNGLTKAIAADFVSKGVRCNCICPAT
VETPSLQERIDAFPDPVKARADFIARQKMGRVGKPEEIAALAVYLASDESGYTTGQELVI
DGGWSLA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggggcgtttggacgggaaagtggcactttgcacggcgtctgcacaggggataggacta
tctacagttctggcatttgctaaggagggagccagagtgatcgctacagatgtcaacatc
agtaaactggagcaggaagtcaaagatgtgccaggaattgaagccaagacactgaatgtg
gcagacaaggaccaggttacagcactggtggaccagttagaccgtgtggacatcctcttc
aactgtgcaggaatagttcacaatggcacaatcctggactgtgaggaggctgactgggac
cagaccatgaatgtgaacctgaagagcatgtacttcctgtgtcgtgctgttcttccaaag
atggtggcacaaggttctgggtctatcgtcagcatgtcctctagtgcttcaagtattaaa
ggtgttcccatgcgttttgcctactccgtcagtaagggaggagtcaacggactgaccaaa
gccatcgctgcagactttgtctccaaaggggttcgctgtaactgtatctgtccagctaca
gtagaaacaccctcgctgcaggagagaatcgacgctttccctgatcctgtcaaggcacga
gcagacttcatcgctcgacagaagatgggtcgcgttggtaagcctgaggagatcgcagcc
ctggccgtgtacctggcatctgatgagtctggatacaccacaggccaggagcttgtgatt
gacggaggctggagccttgcttag

DBGET integrated database retrieval system