KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_280425Help
Entry
BRAFLDRAFT_280425 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bfo00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:bfo00072]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 247 aa AA seqDB search
MGRLDGKVALCTASAQGIGLSTVLAFAKEGARVIATDVNISKLEQEVKDVPGIEAKTLNV
ADKDQVTALVDQLDRVDILFNCAGIVHNGTILDCEEADWDQTMNVNLKSMYFLCRAVLPK
MVAQGSGSIVSMSSSASSIKGVPMRFAYSVSKGGVNGLTKAIAADFVSKGVRCNCICPAT
VETPSLQERIDAFPDPVKARADFIARQKMGRVGKPEEIAALAVYLASDESGYTTGQELVI
DGGWSLA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggggcgtttggacgggaaagtggcactttgcacggcgtctgcacaggggataggacta
tctacagttctggcatttgctaaggagggagccagagtgatcgctacagatgtcaacatc
agtaaactggagcaggaagtcaaagatgtgccaggaattgaagccaagacactgaatgtg
gcagacaaggaccaggttacagcactggtggaccagttagaccgtgtggacatcctcttc
aactgtgcaggaatagttcacaatggcacaatcctggactgtgaggaggctgactgggac
cagaccatgaatgtgaacctgaagagcatgtacttcctgtgtcgtgctgttcttccaaag
atggtggcacaaggttctgggtctatcgtcagcatgtcctctagtgcttcaagtattaaa
ggtgttcccatgcgttttgcctactccgtcagtaagggaggagtcaacggactgaccaaa
gccatcgctgcagactttgtctccaaaggggttcgctgtaactgtatctgtccagctaca
gtagaaacaccctcgctgcaggagagaatcgacgctttccctgatcctgtcaaggcacga
gcagacttcatcgctcgacagaagatgggtcgcgttggtaagcctgaggagatcgcagcc
ctggccgtgtacctggcatctgatgagtctggatacaccacaggccaggagcttgtgatt
gacggaggctggagccttgcttag

DBGET integrated database retrieval system