KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_281260Help
Entry
BRAFLDRAFT_281260 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRAFLDRAFT_281260
   00052 Galactose metabolism
    BRAFLDRAFT_281260
   00500 Starch and sucrose metabolism
    BRAFLDRAFT_281260
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    BRAFLDRAFT_281260
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     BRAFLDRAFT_281260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 361 aa AA seqDB search
MLLLHLEGVSFIQWLQTTFSDFADVLLFLTRMGDPRHAFLVYFPLALVFSRSVGLRTLLV
AIISEWTNLILKWMLHGERPFWWINDPEIYEEGKAPHLEQYSLTCETGPGSPSGHCMVTA
AVLWVVTSALVSDLSAAPCNSWKRNPMIRAAPWLIYSFILTAAGVSRLFIATHFPHQVVF
GTAVGTDITRSKSAKEAIHCPSCQVLLHVYKMVLISKALGPHSCVNTMGIDPSWSIKKAT
QWCAHPEWVHLGTTPFFSVARDSGSSLGLAVALHSILPQVKTARDRTMDSSPEGKTVGVS
TVGFLLLLLSLTLSTEYLVLPQEPQTLLYSLVFVKSALLTVGVIGLVTGFSKLIQKKQKN
W
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgctactcctccatttggagggagtttcattcatccagtggttgcagacgacattttcg
gattttgcggacgtgctgttgtttctgaccaggatgggagacccgaggcacgcctttctt
gtgtacttcccccttgcgctagtcttcagcaggagcgttgggctgagaacactcttagtt
gccattatttccgagtggaccaacctgattctgaaatggatgctacatggagagcgtccc
ttttggtggataaacgaccctgagatatatgaagagggaaaagcgcctcacctggaacag
tattccctgacttgtgagactggaccaggcagcccatcaggccattgcatggtgactgca
gcggtactttgggtggtgacctcagctttggtgtcagatctttcagctgctccatgtaac
agttggaaaaggaaccccatgattagagctgcaccctggctgatctacagtttcattctg
acagcagctggtgtgtccagactcttcattgccacacacttccctcatcaggtggtgttt
ggcactgctgtaggtacggacattacccgatcgaagtctgcgaaggaggctattcactgc
ccatcttgccaagttttgctacatgtatataagatggtgctcatttcaaaagcccttggg
ccacacagttgtgtaaacactatgggcattgatccctcctggtctataaagaaagcgacg
cagtggtgcgcacaccctgagtgggtacacttgggtacaacaccattcttctcagtagcg
cgagattctggctcctctttgggtctggctgtagcactccattcaatcctcccacaggtt
aagactgcgagggatagaaccatggacagtagtcctgaaggtaaaactgttggtgttagc
actgttggcttccttctcttgttgttgtctttaacactgagtactgaatacttggtccta
ccccaggagccacagacattgttgtactcacttgtttttgtcaagagtgcgttattgact
gtaggagtcatcggccttgtaacaggttttagtaaactgattcagaaaaaacagaagaat
tggtaa

DBGET integrated database retrieval system