KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_281384Help
Entry
BRAFLDRAFT_281384 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    BRAFLDRAFT_281384
  Replication and repair
   03420 Nucleotide excision repair
    BRAFLDRAFT_281384
Transcription machinery [BR:bfo03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     BRAFLDRAFT_281384
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 326 aa AA seqDB search
MFYSSTQRKFWTFSSEDELRKLRCQANQDIRQKHEASGKDCSKLLTPDEELMVCQYYHNR
LREFCVKFQPPMPKSVMASASSYFKRVYLQNSVMEHHPKIIMLTCVYMACKVEEFNVSIM
QFVGNIRARSEERERAVDIILNNELQLLQLLNFHLTVHNPIRPLEGLLIDMKTRHRSAEE
VETLRRWAEEYLDKSFLSDACLLFPPSQVALAALWHSGNTVGMDVLSYVHHCLSKNGDGA
DQTLLMNQIKKVQEVVGNVPQLDASLVEEAKAKLAAVGSLEVTHDSQGTKRKQGTEQQGK
QAGKKKAKQAKSAQEDGGLLSLSSLE
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgttctacagcagcactcagaggaaattctggacgttcagcagtgaagatgagctaagg
aaactgagatgccaggccaaccaagacatccgacagaaacatgaagccagcggcaaggac
tgtagcaagctcttaactcctgacgaagagctgatggtctgtcagtattatcacaacaga
ctgagggaattctgtgtgaagtttcagccccccatgcctaagtctgtcatggctagtgct
agttcttacttcaagcgggtctacctccagaactctgtcatggagcatcaccctaagata
ataatgctaacgtgcgtgtacatggcttgtaaggttgaggagtttaatgtctctatcatg
cagtttgtgggaaacattcgcgcccggtcggaggagcgcgagagggccgtggatatcatc
ctgaataacgagttacagctcctacagctcctgaactttcacctcaccgtacacaatccc
atcaggccgctggagggcctcctcattgacatgaagaccaggcaccgttcggcagaggag
gtggaaactctgcgccgctgggccgaggagtatctcgacaagtcgttcttgtcggacgct
tgcctcctgttcccgccttcgcaggtggcgctggctgcactgtggcattctgggaacact
gtcgggatggatgtgctgtcgtacgtccaccactgtctgagcaagaacggtgacggcgcc
gaccaaactctgctgatgaaccaaatcaaaaaggtgcaagaagtagtggggaatgttcca
cagctagacgcaagccttgtggaggaagcgaaagctaaactagctgctgtgggtagcctt
gaggtaacgcacgacagccagggcacaaaaaggaaacagggtacagaacagcagggaaaa
caagcagggaaaaagaaggctaaacaggccaagtcagcacaagaggatggaggactactg
agtctgtcatctctggagtag

DBGET integrated database retrieval system