KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_282352Help
Entry
BRAFLDRAFT_282352 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00600  Sphingolipid metabolism
bfo01100  Metabolic pathways
Module
bfo_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BRAFLDRAFT_282352
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     BRAFLDRAFT_282352
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 7247898
NCBI-ProteinID: XP_002604679
JGI: 282352
UniProt: C3YGG9
AA seq 324 aa AA seqDB search
MPMMAEADVSISVVTTEYSGHAFDVVQSADLSAWGGIVVVSGDGVLYEVVNGLMSRPDWE
QAIKIPLGILPAGSGNGLCYSINYALGEPFEEDRMVHSTFVLLKATMKGHTRPLDLMSVD
TASERRYAFLSFQWGFSADVDIESERYRYLGGSRFLFGSLHNLMKLRLYRGKLSFLPPCP
ASGHRPRRVYGPPSPLLPPLDQPVPADWVTIETDFVTMIIQSISHISEGYFSSPCSSFDD
GVLFLSFLKSGVSRRQMLKFMGKMAEGTQVFDFGSDGGYVCCKAFRVEPVTPPGLMTLDG
EKIEYGPVQGQVHHGVINLIMPND
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgatggcggaggcagacgtctcaataagtgtcgtcaccacagaatactccggc
cacgcgtttgacgtggtacagagtgcggacctgtcggcatggggagggatcgttgttgtg
tccggggacggcgtgttgtatgaggttgtaaacgggctgatgtcgcggcctgactgggaa
caggcgatcaagatccccctcggtatccttcccgccggctcgggaaacggactatgctac
tccattaactatgcactgggggaaccatttgaggaggacaggatggtccattcgacgttc
gtgttgctgaaagccacgatgaaaggccacacccgtcccttggacctcatgtccgtggat
acggcctccgaaaggcgctacgcattcctctccttccagtggggcttctccgccgacgtg
gacatcgaaagcgaacgctaccggtacttgggaggaagtcgctttctttttgggtccctc
cataatctcatgaagctgagattgtacagaggtaaactgtctttcctcccaccatgtcca
gcgagtggccaccgcccccgccgtgtgtacggacctccctcccccctcctccccccgctg
gaccagcccgtcccggccgactgggttaccatagaaaccgacttcgtcaccatgatcatc
cagagcatcagccacatttcggaaggttatttctcgtcgccctgcagctcgttcgacgac
ggcgtcctgttcctgtccttcttgaagtccggcgtgtccaggagacagatgttgaagttc
atggggaagatggcggaggggacccaggtgtttgatttcggcagtgacggcgggtacgtg
tgctgcaaggcgttccgcgtggagcccgtcacaccgcccggactcatgaccctggacggg
gagaagatcgaatacggcccggtacaaggccaggtgcaccacggggtgataaatctgatc
atgcccaacgattaa

DBGET integrated database retrieval system