KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_282392Help
Entry
BRAFLDRAFT_282392 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BRAFLDRAFT_282392
   01230 Biosynthesis of amino acids
    BRAFLDRAFT_282392
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRAFLDRAFT_282392
   00051 Fructose and mannose metabolism
    BRAFLDRAFT_282392
   00562 Inositol phosphate metabolism
    BRAFLDRAFT_282392
Enzymes [BR:bfo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BRAFLDRAFT_282392
Exosome [BR:bfo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BRAFLDRAFT_282392
  Exosomal proteins of bladder cancer cells
   BRAFLDRAFT_282392
  Exosomal proteins of melanoma cells
   BRAFLDRAFT_282392
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 251 aa AA seqDB search
MAGNNRKFFVGGNWKMNGSKDSINEICGWLTAGDRGDTEVVVGPPTAYLGYVQEKLAGSG
VQAAAQNCYKVPKGAFTGEISPAMIKDIGCEWVILGHSERRNVFGESDELIAEKIEHALA
EGLKVIACIGEKLEEREGGQTEEVVFRQTKAFKDKVKDWGKVVLAYEPVWAIGTGKVATP
QQAQEVHASLRTWLSENVSPAVANSLRIIYGGSVSASNCKELATQGDIDGFLVGGASLKP
DFVKIINARKA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggcgggaaacaaccgaaagtttttcgtgggcgggaactggaagatgaacggcagtaaa
gactccatcaacgagatctgtgggtggctgacggccggggacaggggagacaccgaggtt
gttgtcggccctcccaccgcctacctgggctatgtgcaggagaagttggcaggatctggt
gtccaggcagcagcacagaactgttacaaggtgcctaaaggagctttcactggggagatc
agtcctgctatgatcaaggacatcggctgtgagtgggtcatcttgggtcactcagagagg
aggaatgtgtttggggagtctgatgagctgattgctgagaagatagaacatgcccttgca
gaggggttgaaggtcatcgcctgtatcggagagaagctggaggaacgagaggggggacag
actgaggaggttgtcttcaggcagaccaaggctttcaaagacaaggtgaaagattggggc
aaggtggttcttgcttatgaaccagtctgggccatcgggactggcaaggtggcaacccct
caacaggcccaggaagtccacgccagtctgcgcacctggctatctgagaacgtgtctcct
gcagtagctaactcactccgcatcatctatggaggttcggtgtcagccagtaactgcaaa
gaactcgccacccagggtgacatcgatggcttcctcgtgggcggagcctccctgaagcca
gacttcgttaaaattatcaatgcacgcaaagcttga

DBGET integrated database retrieval system