KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_282392Help
Entry
BRAFLDRAFT_282392 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00010  Glycolysis / Gluconeogenesis
bfo00051  Fructose and mannose metabolism
bfo00562  Inositol phosphate metabolism
bfo01100  Metabolic pathways
bfo01200  Carbon metabolism
bfo01230  Biosynthesis of amino acids
Module
bfo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bfo_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRAFLDRAFT_282392
   00051 Fructose and mannose metabolism
    BRAFLDRAFT_282392
   00562 Inositol phosphate metabolism
    BRAFLDRAFT_282392
Enzymes [BR:bfo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BRAFLDRAFT_282392
Exosome [BR:bfo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BRAFLDRAFT_282392
  Exosomal proteins of bladder cancer cells
   BRAFLDRAFT_282392
  Exosomal proteins of melanoma cells
   BRAFLDRAFT_282392
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM CutC
Motif
Other DBs
NCBI-GeneID: 7248006
NCBI-ProteinID: XP_002610851
JGI: 282392
UniProt: C3XYH6
AA seq 251 aa AA seqDB search
MAGNNRKFFVGGNWKMNGSKDSINEICGWLTAGDRGDTEVVVGPPTAYLGYVQEKLAGSG
VQAAAQNCYKVPKGAFTGEISPAMIKDIGCEWVILGHSERRNVFGESDELIAEKIEHALA
EGLKVIACIGEKLEEREGGQTEEVVFRQTKAFKDKVKDWGKVVLAYEPVWAIGTGKVATP
QQAQEVHASLRTWLSENVSPAVANSLRIIYGGSVSASNCKELATQGDIDGFLVGGASLKP
DFVKIINARKA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggcgggaaacaaccgaaagtttttcgtgggcgggaactggaagatgaacggcagtaaa
gactccatcaacgagatctgtgggtggctgacggccggggacaggggagacaccgaggtt
gttgtcggccctcccaccgcctacctgggctatgtgcaggagaagttggcaggatctggt
gtccaggcagcagcacagaactgttacaaggtgcctaaaggagctttcactggggagatc
agtcctgctatgatcaaggacatcggctgtgagtgggtcatcttgggtcactcagagagg
aggaatgtgtttggggagtctgatgagctgattgctgagaagatagaacatgcccttgca
gaggggttgaaggtcatcgcctgtatcggagagaagctggaggaacgagaggggggacag
actgaggaggttgtcttcaggcagaccaaggctttcaaagacaaggtgaaagattggggc
aaggtggttcttgcttatgaaccagtctgggccatcgggactggcaaggtggcaacccct
caacaggcccaggaagtccacgccagtctgcgcacctggctatctgagaacgtgtctcct
gcagtagctaactcactccgcatcatctatggaggttcggtgtcagccagtaactgcaaa
gaactcgccacccagggtgacatcgatggcttcctcgtgggcggagcctccctgaagcca
gacttcgttaaaattatcaatgcacgcaaagcttga

DBGET integrated database retrieval system