KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_284587Help
Entry
BRAFLDRAFT_284587 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bfo00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bfo00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 346 aa AA seqDB search
MSGKISVEDFGTTPEGQAVQRFVLRNNNNVCLKLISYGATIQAIEVPDKDGKVADVTLGF
DTLDGYLGKHPYMGVVAGRVANRIAKGTFSLDGQEYKLACNNGPNHLHGGLKGFSHYVWD
SSVEGDSVKFTYVSADGEEGYPGEVTAQVTYKLTNDNEVDIQYQATTTKATPINLTNHAY
FNLAGHSEATIYDHIITIMADKYTPTDDDALTTGEISPVEGTLWDLREGVRMGDRVNSVP
GKAPGYDQNFCITQPGDNQLCARAQHPASGRTMEVRTNQPGVQFYTASYLDGTLAGKGGA
KYNKHAGFCLETQVYPDAINKPHFPSSVLRPGETYHHHTSYKFVLG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggaaaatttctgtggaagactttgggacgacacctgaaggacaagctgtccag
cgctttgtcctcaggaacaacaacaacgtctgcctaaagctcatctcctacggagcgaca
atccaggccatagaagtgccggataaggacgggaaggttgccgacgtgacactaggattt
gatactttagatggctaccttggcaagcatccctacatgggtgttgtggctgggagagtt
gccaacaggatagccaaggggaccttctcactggatgggcaggagtacaagttggcctgt
aacaacggtccaaaccacctgcatggtggactgaagggcttcagccattatgtgtgggac
agcagtgtggaaggagacagcgtcaagttcacctatgtgagcgccgacggtgaggagggc
tatcctggggaggtcaccgctcaggtcacctacaagctgaccaatgacaacgaggttgac
atccagtaccaggccaccacaaccaaggcaacacccatcaacctcaccaaccatgcctat
ttcaacttggcagggcacagcgaggcaactatctacgaccacattattaccatcatggca
gacaagtacacaccaactgatgatgacgcccttacaacaggtgagatcagcccagtggag
ggcaccctgtgggacctgcgtgagggggtgaggatgggcgaccgtgtcaactccgtccca
gggaaggcacctggctacgaccagaacttctgcatcacacagccgggagacaaccagctg
tgtgccagggcccagcatccagccagtggccggactatggaggtgcggacgaaccagccc
ggggtgcagttctacacggccagctacctggatgggacgctggctggcaagggtggggcc
aagtacaacaaacatgcaggcttttgtctggaaacccaggtctaccctgatgccatcaac
aaaccccacttccccagcagtgtgctgcgcccaggcgagacgtaccaccaccacacctcc
tacaagtttgtgctggggtag

DBGET integrated database retrieval system