KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_285264Help
Entry
BRAFLDRAFT_285264 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:bfo00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 310 aa AA seqDB search
MAGNTGAPLLLRLVAASVSVAEKAGTIVRDVFNSGELGVVEKGGKNDLQTQADRSAQECI
VQSLSRQFPKVTIIGEEEPTDEVVDESHLETGLSEEVLKAVCPQDLQAVKDEDVVVWVDP
LDGTKEYTEGFLDHVTVLIGVAVNGKAVAGVINQPYYNYKAGPGATLGRTMWGIVGLGAF
GVERLVPPADKRIVTTTRSHSNKLVTESIEAMQPDEVLRVGGAGHKVLLVIEGKAHAYVF
ATPGCKKWDTCAPEAILHALGGKLTDIHGNALQYHRDVKHPNTGGVLATYSDHDWYLGRM
PESVKAAVKP
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtaacacaggtgctcctctactgctccgtctggtggccgcatcagtttctgta
gcggaaaaggcaggaacgatcgtcagggatgtgttcaacagcggagagctgggggtggta
gaaaagggagggaaaaacgacctgcagacccaggctgaccgctctgctcaggagtgtatt
gtacagtcactgtccagacagttccctaaggtcaccatcataggagaggaggagccaaca
gatgaggtagtggatgagtcacacctggagactgggttgtcagaggaggtgttgaaagca
gtttgtcctcaagacctccaggctgttaaggatgaagatgtggtcgtatgggtggaccct
ctggatggtactaaggaatacacagaaggtttcctggaccatgtaacagtgttgataggt
gtggctgtgaatgggaaggcagtggcaggagtcattaaccagccttactacaactacaag
gctggtccaggagcgactcttggtcgtaccatgtggggtattgttggactgggagcattt
ggtgtggagcgtttggttccgcctgctgacaaaaggattgtaaccaccaccagatcccac
tccaacaagctggtgacagagtccatagaggccatgcagcctgatgaagtcctgagggtg
gggggagctgggcacaaggtgctgctagttattgaaggaaaggctcatgcgtatgtgttt
gccacacctggctgcaagaagtgggacacctgtgcacctgaagccatcctccacgccctg
gggggcaagctgacggacatccacgggaacgccctgcagtaccacagggatgtgaagcac
cccaacactggaggtgtcctggccacgtacagcgatcatgactggtacctgggcaggatg
cctgagtcagtcaaggcagctgtgaaaccctga

DBGET integrated database retrieval system