KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_287383Help
Entry
BRAFLDRAFT_287383 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     BRAFLDRAFT_287383
Exosome [BR:bfo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BRAFLDRAFT_287383
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 139 aa AA seqDB search
MFLAVVLVMGLVCSAHAKTYERCELARELVSRGLTSRSQAGEWICLVQHESSFRTGARGG
PNWDGSYDHGLFQINDHYWCDNGGPHNDCGVSCSNLRDNNIADDVRCAKLIYQRHGFSAW
YGWQNNCQGSTSSYVSGCF
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgttcctggctgtggtactagtgatggggcttgtgtgctcggcgcatgccaagacctac
gagcgctgtgaactggcgagagagctggtgtcccgcgggctgacttcgcgatcccaggcc
ggcgaatggatctgtctggttcagcacgagagttccttcaggactggagccagaggcggc
cccaactgggacggatcctacgatcacgggctgttccagatcaacgatcactactggtgc
gacaacggtggaccacacaacgactgtggcgtctcctgctccaacctccgtgacaacaac
atcgctgatgacgtcaggtgtgccaagctgatctaccagcgtcacggcttctctgcctgg
tatggctggcaaaacaactgccagggcagcacctccagctacgtcagcggctgtttctag

DBGET integrated database retrieval system