KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_287617Help
Entry
BRAFLDRAFT_287617 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    BRAFLDRAFT_287617
Enzymes [BR:bfo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     BRAFLDRAFT_287617
Chaperones and folding catalysts [BR:bfo03110]
 Protein folding catalysts
  Protein disulfide isomerase
   BRAFLDRAFT_287617
Membrane trafficking [BR:bfo04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    BRAFLDRAFT_287617
Exosome [BR:bfo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BRAFLDRAFT_287617
  Exosomal proteins of colorectal cancer cells
   BRAFLDRAFT_287617
  Exosomal proteins of bladder cancer cells
   BRAFLDRAFT_287617
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 OST3_OST6 Thioredoxin_7 Thioredoxin_8 Calsequestrin AhpC-TSA Redoxin Glutaredoxin TraF
Motif
Other DBs
NCBI-GeneID: 7225218
NCBI-ProteinID: XP_002595781
JGI: 287617
UniProt: C3Z6N3
AA seq 486 aa AA seqDB search
MKVFVAIFATFVALSLAGDYSEEEDVLVLTNDNFEAAIAEFENILVEFYAPWCGHCKALA
PEYAKAAGSLKEKESAIKLAKVDATVESDIAQKFEVRGYPTMKFFRNGKPMEYGGGRQAD
QIVTWLEKKTGPPAANLETADQAEKLKEDNEVLVVGFFKDQESDGAKAFLEVARSDDETT
FAITSTDEVYTKLEAKGDGVVLFKKFDEGRNDFEGDVKEDDLKQFIKENQLPLVVEFTES
TAQKVFGGEVKNHNLLFISKEHEDFDGILEQFRGAAAEFKGKILFIYINVDNDDHSRILE
FFGLNKEECPQVRLISLDEDMTKYKPETEEITTENMKAFVQGFIDKTIKAFLMSQDVPED
WDKEGVKVLVGKNFREVALDENKAVLVEFYAPWCGHCKQLAPIYDELGEKFKDSEDIVVA
KMDSTANEVEDVKIQSFPTIKYFPKGKDSQVVDYNGERTLEAMAKFLESGGKDGAGPSDE
VSHFPF
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttttcgtcgcaattttcgccacttttgtggccctgtccctggcaggagactac
tcagaagaggaggacgtcctggttctaaccaacgacaacttcgaggcggcgatagcagag
tttgagaacatcctagtcgagttttatgccccatggtgtggacactgcaaggcgctggct
cccgagtacgccaaggccgcgggcagtctgaaggagaaggagtccgccatcaagctggca
aaggtggacgccaccgtggagtccgatatcgcgcagaagtttgaagtacgtggctacccc
accatgaagttcttccgcaacggaaagcccatggagtatggcggtggtcgtcaggctgac
cagatcgtgacctggctggagaagaagactggcccccctgccgccaacctggaaactgct
gaccaggccgagaaactgaaggaagacaacgaggtcctggtcgtgggcttcttcaaggac
caagagagtgatggtgccaaggccttcctagaggtggccagatctgacgacgagaccacc
ttcgctatcacatcaacagacgaggtctacaccaagctggaggctaagggtgatggtgtg
gtcttgttcaaaaagtttgacgaaggccgtaacgacttcgagggcgatgtgaaggaagac
gacctgaaacagttcatcaaggagaaccagctgcccctggtggtggagttcacagaatcg
actgcccagaaggtgttcggtggagaagtgaagaaccacaacctgctgtttatcagtaag
gaacatgaggacttcgacggcatcttggaacagttcaggggtgctgctgccgaattcaag
ggcaagattttgtttatctacatcaatgttgacaacgatgaccactcccgtatcctggag
ttcttcggcctgaacaaggaggagtgcccgcaggtccgcctgatctcgctggacgaggac
atgaccaagtacaagcccgagacagaggaaatcaccacagagaacatgaaggctttcgtg
cagggattcattgataaaaccattaaggcattcctgatgagccaggatgttccagaggat
tgggataaggagggagtcaaggttctggtcgggaagaactttcgtgaggtggccctggat
gagaacaaagccgtgctggtcgagttttatgcaccttggtgcggccactgcaagcagctg
gcgcccatctacgatgagctgggtgagaagttcaaggacagcgaggatatcgtggtcgcc
aagatggactccacagcgaacgaggtggaagacgtgaaaatccagagcttccccaccatc
aagtatttccccaaaggaaaagattcccaggttgttgattacaacggggagcggacatta
gaggccatggccaagttcctagaatcaggcggaaaggacggtgcagggcccagtgacgag
gtaagtcactttccattttaa

DBGET integrated database retrieval system