KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_287617Help
Entry
BRAFLDRAFT_287617 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:bfo04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 486 aa AA seqDB search
MKVFVAIFATFVALSLAGDYSEEEDVLVLTNDNFEAAIAEFENILVEFYAPWCGHCKALA
PEYAKAAGSLKEKESAIKLAKVDATVESDIAQKFEVRGYPTMKFFRNGKPMEYGGGRQAD
QIVTWLEKKTGPPAANLETADQAEKLKEDNEVLVVGFFKDQESDGAKAFLEVARSDDETT
FAITSTDEVYTKLEAKGDGVVLFKKFDEGRNDFEGDVKEDDLKQFIKENQLPLVVEFTES
TAQKVFGGEVKNHNLLFISKEHEDFDGILEQFRGAAAEFKGKILFIYINVDNDDHSRILE
FFGLNKEECPQVRLISLDEDMTKYKPETEEITTENMKAFVQGFIDKTIKAFLMSQDVPED
WDKEGVKVLVGKNFREVALDENKAVLVEFYAPWCGHCKQLAPIYDELGEKFKDSEDIVVA
KMDSTANEVEDVKIQSFPTIKYFPKGKDSQVVDYNGERTLEAMAKFLESGGKDGAGPSDE
VSHFPF
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttttcgtcgcaattttcgccacttttgtggccctgtccctggcaggagactac
tcagaagaggaggacgtcctggttctaaccaacgacaacttcgaggcggcgatagcagag
tttgagaacatcctagtcgagttttatgccccatggtgtggacactgcaaggcgctggct
cccgagtacgccaaggccgcgggcagtctgaaggagaaggagtccgccatcaagctggca
aaggtggacgccaccgtggagtccgatatcgcgcagaagtttgaagtacgtggctacccc
accatgaagttcttccgcaacggaaagcccatggagtatggcggtggtcgtcaggctgac
cagatcgtgacctggctggagaagaagactggcccccctgccgccaacctggaaactgct
gaccaggccgagaaactgaaggaagacaacgaggtcctggtcgtgggcttcttcaaggac
caagagagtgatggtgccaaggccttcctagaggtggccagatctgacgacgagaccacc
ttcgctatcacatcaacagacgaggtctacaccaagctggaggctaagggtgatggtgtg
gtcttgttcaaaaagtttgacgaaggccgtaacgacttcgagggcgatgtgaaggaagac
gacctgaaacagttcatcaaggagaaccagctgcccctggtggtggagttcacagaatcg
actgcccagaaggtgttcggtggagaagtgaagaaccacaacctgctgtttatcagtaag
gaacatgaggacttcgacggcatcttggaacagttcaggggtgctgctgccgaattcaag
ggcaagattttgtttatctacatcaatgttgacaacgatgaccactcccgtatcctggag
ttcttcggcctgaacaaggaggagtgcccgcaggtccgcctgatctcgctggacgaggac
atgaccaagtacaagcccgagacagaggaaatcaccacagagaacatgaaggctttcgtg
cagggattcattgataaaaccattaaggcattcctgatgagccaggatgttccagaggat
tgggataaggagggagtcaaggttctggtcgggaagaactttcgtgaggtggccctggat
gagaacaaagccgtgctggtcgagttttatgcaccttggtgcggccactgcaagcagctg
gcgcccatctacgatgagctgggtgagaagttcaaggacagcgaggatatcgtggtcgcc
aagatggactccacagcgaacgaggtggaagacgtgaaaatccagagcttccccaccatc
aagtatttccccaaaggaaaagattcccaggttgttgattacaacggggagcggacatta
gaggccatggccaagttcctagaatcaggcggaaaggacggtgcagggcccagtgacgag
gtaagtcactttccattttaa

DBGET integrated database retrieval system