KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_288748Help
Entry
BRAFLDRAFT_288748 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Enzymes [BR:bfo01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     BRAFLDRAFT_288748
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 675 aa AA seqDB search
MDPDETQSVPLPAATEEEPFLGMTDIFLVCMILGLTIYWWFFRDRKAAATPQQLVKPLTV
VPLSTASRDPSFINRMKKTKKNVAVFYGSQTGTAEEFAGRLARDCIRYGLKGFAVDPEEC
EMEELTRMGEVESSFALFCLATYGEGDPTDNAQEFFDWLQEDHDLSELRYAVFGLGNKTY
EHFNAMGIFVDKRLEEMGAVRLCTAGMGDDDANIEEDFVTWRETLWPAVCEHFGIESVGE
EGVMRQYTLEKHEDINQNEIFTGEPTRLNSLTQQKPPYDAKNPYMSSVKVNRELHKGGDR
SCMHIEFDISGSRIRYEAGDHVAVYPTNDPSMVEEIAHLLNVNLDEVFTLNNVDDEAAKK
HPFPCPTTYRTALLHYVDITHPPRTNVLHDIIDYASDPKDREFLTRITASAGKKEFAEWV
TESHRDILQILKDLPSLKPPLDHLCELLPRLHARYYSISSSPKEHPERIHITAVLVDYHS
KIDRRIKGVATNWLATKIPNGPDGPRVPIYVRKSPFRLPFKTTTPVIMIGPGTGLAPFRG
FIQERHHAKTEGKPIGDTVLFSGCRKKSEDYIYQEELEGYEGDGTLSQLNMAFSRDQAQK
VYVQHLIKQKSESVWNLLNDGAHLYVCGDARHMAHDVDMVLHEIVEKNGNMTQSQAKDFI
KGLRNKGRYACDVWS
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggaccctgacgagacccagtccgtgccgttgccggcggcaacagaagaggagccgttc
ctcgggatgacggacatcttcctggtgtgcatgatcctggggctcaccatctactggtgg
ttcttccgggacaggaaggccgccgccacgccgcaacagctcgtcaaacctctcactgtc
gttccactgtcaactgcaagcagagatccaagctttatcaaccgcatgaagaaaacgaag
aagaatgtagcagtgttttacggctcccagacgggcactgccgaggagtttgccggcaga
ctggcgcgggactgtatacgctacgggctgaagggcttcgctgtagacccagaggagtgt
gaaatggaggagctgaccagaatgggggaggtagagagctcctttgctctcttctgtctg
gcgacttacggtgagggcgacccgacagacaacgcgcaggagttctttgattggctacag
gaggaccacgatcttagtgagctcagatatgctgtgtttgggttaggaaacaagacctat
gagcacttcaacgccatgggaatttttgtggacaagaggcttgaagagatgggtgctgtc
agactctgtacagccggaatgggggacgatgatgcaaatattgaggaggactttgtaacg
tggagagagaccttgtggccagcggtgtgcgaacacttcggtatcgaatctgtgggagaa
gagggagtgatgaggcagtacacactggagaaacacgaggacatcaaccagaacgagatc
ttcacgggagagcccacacggctcaactcactcacacaacagaaaccaccttacgatgcc
aagaacccgtacatgtcatctgtcaaggtgaaccgagagctgcacaagggaggggaccgg
tcctgcatgcacatcgagtttgacatctcaggatccaggattaggtacgaggcaggtgac
cacgtggccgtttacccgaccaacgacccctccatggtggaggaaatcgctcacctcctc
aacgtcaacctggacgaagtcttcactctcaacaacgtggatgatgaggcagccaagaag
cacccgttcccgtgcccaacgacgtaccgcaccgccctcctgcactacgtggacatcacc
caccccccgcgcaccaacgtcctccacgacatcatcgattacgcctccgaccccaaggac
agggagttcctcaccaggatcactgcatccgctggaaagaaagagtttgctgagtgggtg
acggagagccaccgtgacatcctgcagattctgaaggaccttccgtccctcaagccgccc
ctggaccacctatgtgagctgctgccgcgcctgcacgcccgctactactccatctcctcc
tctccaaaggaacatcccgagagaatccacatcactgccgtcctggtggactaccacagt
aagatcgaccgcaggataaagggcgtggccaccaactggctcgccaccaagatccccaat
ggccccgatggcccgcgcgtccccatctacgtccgcaagtcgccgttccgcctcccgttc
aagaccacgacccccgtcatcatgatcggccccgggaccgggctggcgccgttccgaggg
ttcatccaggagaggcatcacgccaagaccgaaggcaaaccaatcggagacaccgtgctg
ttctcgggctgccgcaagaagtcggaggactacatctaccaggaggagttggaaggatac
gagggagacgggacgctttcgcagctcaacatggcgttctcccgcgaccaggcacagaag
gtgtatgtgcagcacctcatcaagcagaagtcggagtcagtctggaacctgctgaacgat
ggggcacatctgtatgtgtgcggagacgcccgtcacatggcgcacgacgtggacatggta
ctgcacgagatcgtggagaagaacggaaacatgactcagagccaggccaaggacttcatc
aaggggctcaggaacaagggcagatacgcctgcgacgtctggagctaa

DBGET integrated database retrieval system