KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_290865Help
Entry
BRAFLDRAFT_290865 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BRAFLDRAFT_290865
Enzymes [BR:bfo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     BRAFLDRAFT_290865
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 936 aa AA seqDB search
MFFPIAFVAARQLARPLFVRGFSTSQVYAANKMKIAVIGQSQFGTEVYNLLKKEGHEIVG
VFTIPDLQGKPDPLAVAGEKDGVPTFKFPRWRVKGQSIPEVVQQYQACGADLNVLPFCSQ
FIPMDVINTPKHGSIIYHPSILPRHRGASAINWTLIHGDKKAGFTIFWADDGLDTGPILL
QKECYAGPNETLDGLYNKFLYPEGIKAMAEAVQLIADGKAPRIPQSEDGATYEPMLKKKE
SVQINWDQTGEALHNFIRGNDKLPGAWTTINGEQVTLYGSKMFKKEVPEGTEVEVPGASK
PAIVHKGGMIFTGNDGKMLNVKNLQFADGSMIPAKMFGKADAGGATLELTAEEKDLEGQL
KDVWKGILSIAEIQGETDFFKAGAGSMDVVRLVEEVLQRCSDVSLQNEDVYMNTTFHDFM
QMVVRKARGLDEPDEFEYDAIEMHVNNLKLEFPNQLFINNEFVDASNGATFDTINPTDES
VICKVSKGTKDDVNTAVKAAKEAFEDGPWGKMNPRDRGKLMYRLADLMDEHKEELATLEA
IDSGAVYTLALKTHVGMSIDTFRYYAGWCDKIMGTTIPINQARPNHNLTYTKREPVGVVG
LIVPWNYPLMMLAWKMGAALTPGNTIVLKPAQVTPLTALKFAELAVKAGFPPGVINILPG
AGSQVGQAILDHPDVRKVGFTGSTPVGKDIMRSCAVSNLKRVSLELGGKSPLVIFNDCDL
DRAVRQSLSGCFFNKGENCIASGRLFVEESIHDEFVTRVVEEIKKMKIGDPLDRSVDHGP
QNHLAHFNSLLEYCKVGVEQGAKLVYGGTRVDRPGLFLHPTVFTDVTDDMWIAEEESFGP
VMIISKFKDGDIDGMLKSANNTEFGLASGVFTKDINKALYVADNLQAGTVFVNTYNKTDV
AAPFGGFKQSGFGKDLGQEALHEYTRTKAVTVEYWL
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atgttcttcccgatcgcgtttgtggctgccaggcagttggctcggccgctgttcgtgcga
ggcttctccacctctcaggtctacgctgctaacaagatgaagatcgctgtgattggtcag
agccagttcggtacggaggtgtataacctcctaaagaaggaaggtcacgagatcgtcggc
gtcttcaccattccagacctgcaggggaagccggatcctttagccgtagcaggagagaag
gacggcgttcccaccttcaagttcccgcggtggcgcgtgaagggccagtccatcccggag
gtggttcagcagtaccaggcgtgcggagccgacctgaacgtgctgccgttctgctcgcag
ttcatccccatggacgtcatcaacaccccgaaacacggctccatcatctaccacccctcc
atcctccccaggcacaggggggcctccgctatcaactggacgctgatccacggagacaag
aaagccggcttcaccatcttctgggcggacgatgggctggacacggggcccatcctgctg
cagaaggagtgctacgctgggcctaacgagacgctggacgggctgtacaacaagttcctg
taccccgagggtatcaaggctatggcggaagcggtacagctgatcgctgacgggaaagcg
ccgaggattccccagtcagaggacggagccacgtacgaacccatgctgaagaagaaggag
tctgtgcagatcaactgggaccagaccggcgaggccctccataactttatccgagggaac
gacaagctgccgggcgcctggacaaccatcaacggggagcaagtcacgctgtacggctcc
aagatgttcaagaaggaggttccggaggggacggaggttgaagttcccggcgcgagcaaa
cccgccatcgtgcacaagggcggcatgatcttcacggggaacgacggcaagatgctgaat
gtgaagaacctccagtttgcggacggctccatgatcccagcgaagatgttcgggaaggcg
gacgccggcggcgccacgctggagctgacagccgaggagaaggatctggagggacagctc
aaggatgtgtggaagggaatcctgtccatagcagagatccagggagaaactgacttcttc
aaggccggagccggctccatggacgtggtcaggctggtggaggaggtactgcagcgctgc
tcggacgtgagtctgcagaacgaagacgtctacatgaacacaaccttccacgacttcatg
cagatggtggtccgcaaggcacgcggcctggacgagccggacgagtttgagtacgacgct
attgagatgcacgtgaacaacttgaagctggagttccccaatcagctgttcatcaacaac
gagtttgtcgacgcgtccaacggagcgaccttcgacaccatcaaccccacagacgaatcc
gtgatctgcaaggtgtcgaaaggaacgaaggatgacgtgaacacggccgtgaaggccgcg
aaggaggcgttcgaggacgggccgtggggcaagatgaacccaagggacaggggcaagctc
atgtacaggttggcagacttgatggacgagcacaaagaggagctggctacactcgaggcc
atcgactcgggcgctgtgtacacgctggcactgaagactcacgtggggatgtccatcgac
accttccgctactacgctggctggtgcgacaagatcatgggcacgaccatccccatcaac
caagcccgacccaaccacaacctcacctacaccaaacgcgagcctgtcggtgttgttggt
ctgatcgtcccgtggaactatccgctgatgatgttagcgtggaagatgggcgctgcgctc
acgccggggaacacgatcgtgctcaaacctgcacaggtgacgcctctgacggccctgaag
tttgctgagctggctgtgaaggctgggttccctcctggtgttatcaacatcctacctggg
gcaggttcccaggtggggcaggccatcttggatcaccccgacgtgaggaaagtcggcttc
acggggtccactcctgtgggcaaggacatcatgaggagttgtgctgtcagtaacctgaag
agagtgtctctcgagctgggcggaaagtctcccctcgtcatcttcaatgactgtgacctg
gacagggccgtcagacagagtctgagcggatgtttcttcaacaaaggagagaactgcatc
gcttccgggcggctgtttgtggaggagtccatccatgacgagttcgtcaccagggtggtg
gaggagataaagaagatgaagatcggagatccgctggacagatctgtggatcacggacct
cagaaccacctcgctcactttaactccctcctggagtattgcaaggttggagtggagcag
ggagccaagctggtgtacgggggcaccagggtcgacagaccaggcctgttcctgcacccc
acggtgttcacagacgtgacagacgacatgtggattgccgaggaggagtcgttcggaccc
gtcatgatcatcagcaagttcaaggacggagacattgacgggatgctgaagagcgccaac
aacacggagttcggcctggcgtccggcgtgttcaccaaggacatcaacaaggcgctgtac
gtggccgacaacctgcaggccgggacagtcttcgtcaacacctacaacaagacggacgtc
gccgcgcccttcggaggcttcaagcagtcagggttcggcaaggatcttggccaggaggcg
ctgcacgagtacaccagaaccaaggctgtcactgtggagtactggctgtga

DBGET integrated database retrieval system