KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_290938Help
Entry
BRAFLDRAFT_290938 CDS       T01074                                 

Definition
(RefSeq) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00072  Synthesis and degradation of ketone bodies
bfo00650  Butanoate metabolism
bfo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BRAFLDRAFT_290938
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BRAFLDRAFT_290938
Enzymes [BR:bfo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     BRAFLDRAFT_290938
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR
Motif
Other DBs
NCBI-GeneID: 7219055
NCBI-ProteinID: XP_002612557
JGI: 290938
UniProt: C3XTR6
AA seq 345 aa AA seqDB search
MSARLRSAVFITFLLPCLYIVANVEPWAQIASVVFVALLSWFVCDFVVPVAVVNGEGRAV
LVTGCDTGFGHLVAKRLHDLGFTVFAGCLLKDRGGDGARDLAAMASPRLHVVQMDVTSDD
SVWKVRRYMDAHLPQGTSGLWAILNNAGTSTYGLVEWCPIETYKRVAEVNLWGTVRVTKV
FLPLVRKAKGRVINISTVLGRSSTPSRSAYCITKYGVESFSDVLRYEMKRWGVDVSIIEP
GNFISATNIFTEESIENTALELWDGMTEEVKEAYGKKALDDYKLLMHQYATEGSRDTSPV
VDAMVAAVVAVSPKVRYKPMQFYWHVKTFVMTHLPEWIADNIYIY
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctcgtttacgctctgctgtcttcataacattccttcttccatgtctatatata
gtcgccaatgtagagccgtgggctcagatagcttctgtagtgtttgtagcgctgctgtca
tggtttgtttgtgattttgtggtgccggtggctgtggtgaatggggagggcagggccgtg
ttggtgaccggctgtgacactggattcggtcacctggtggcaaaacggcttcacgacttg
ggcttcactgtgttcgctggatgtctgttaaaggacaggggaggtgatggtgcacgtgat
ctggcagccatggcctctccacgtctccatgtggtacagatggatgtgaccagtgacgac
agcgtgtggaaggtgcgcaggtacatggacgctcacctgcctcagggtacctcaggcttg
tgggccatcctgaacaatgcgggcacgtccacctatggtctggtggagtggtgtcccata
gagacctacaaacgggtggcagaggtcaacctgtggggcacggtcagggtcaccaaagtc
ttcctgccacttgtacggaaagcaaaaggccgagtaatcaatatttctactgtgctgggt
cgcagcagcacgccctcccgctcagcatactgtatcacgaagtacggtgtggagagcttc
tcggacgtcctgaggtacgagatgaaacggtggggtgtggacgtcagcatcatcgagcca
ggaaacttcatcagcgccaccaacatcttcactgaagagtctatagagaacacagctctg
gaactttgggacggcatgacagaggaagtgaaagaagcctatggtaagaaagccctggat
gactacaaactcctgatgcaccagtacgccaccgagggcagccgggacacctcacctgtg
gtggacgccatggtggcagctgtggttgctgtcagccccaaagtgcggtataaacccatg
cagttctactggcatgttaaaacttttgtcatgacacatctaccagagtggatcgcagac
aacatatacatctactga

DBGET integrated database retrieval system