KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_56959Help
Entry
BRAFLDRAFT_56959  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Exosome [BR:bfo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BRAFLDRAFT_56959
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 121 aa AA seqDB search
MPPKGGGKAAKKAGKARPAGAKGKRRRKRRETFGVYIYKVLKQVHPDTGVSSKAMGIMNS
FVNDIFERIAAEASRLAHYNKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
K
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgccgcctaaaggaggaggaaaagccgcaaagaaggccggtaaggcaaggcccgctgga
gccaagggaaagaggaggagaaagaggagggagaccttcggtgtctacatctacaaggtg
ctcaagcaggtgcaccccgacaccggtgtctccagcaaggccatgggaatcatgaactcc
ttcgtcaacgacatcttcgagcgtatcgccgctgaggcttcccgcctggctcactacaac
aagcgctccaccatcagcagccgggagatccagaccgccgtgcgtctgctgctgcctggt
gagttggccaagcacgccgtcagcgagggcaccaaggccgtcaccaagtacaccagctcc
aagtaa

DBGET integrated database retrieval system