KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_56971Help
Entry
BRAFLDRAFT_56971  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 121 aa AA seqDB search
MPPKGGGKAAKKAGKARPAGAKGKRRRKRRETFGVYIYKVLKQVHPDTGVSSKAMGIMNS
FVNDIFERIAAEASRLAHYNKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
K
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgccgccaaaaggaggaggaaaagctgcgaaaaaggccggtaaggccaggcccgccgga
gccaagggcaagaggaggagaaagaggagagagaccttcggtgtctacatctacaaggtg
ctcaagcaggtgcaccccgacaccggtgtctccagcaaggccatgggcatcatgaactcc
ttcgtcaacgatatcttcgagcgtatcgccgctgaggcttcccgcctggctcattacaac
aagcgctccaccatcagcagccgggagatccagaccgccgtgcgtctgctgctgcctggt
gagctggccaagcacgccgtcagcgagggcaccaaggccgtcaccaagtacacaagctcc
aagtaa

DBGET integrated database retrieval system