KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_57175Help
Entry
BRAFLDRAFT_57175  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    BRAFLDRAFT_57175
  Replication and repair
   03420 Nucleotide excision repair
    BRAFLDRAFT_57175
Transcription machinery [BR:bfo03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     BRAFLDRAFT_57175
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 457 aa AA seqDB search
MAAAGTKKLDCKDLHGYLKTLGSSLLDELYGRPATCLAVFRELTDLAKHYVMRLLFLEQA
VPQAVVGSWVTSGNHSEHLRAVSQLSELRVWHEHQISGGLAGWILSPTFRANLRTALLGG
GKPWFSVVQLPPDKHAKDVAALDTYSLERWEVLLNFIVGSGEAQVSKDIMEILIKSGLMK
SEEGSLHPTITPAGFQFLLMDTPSQVWYIILQYLDTMQSRGLNLVEALQFLFQISFSTLG
KDYPTEGMSDSMQQFLQHLRELGLVNQRKRKSGRFYPTRLAIHLASGISDVEKDFHKEGY
LVVESNYRIYAYTDSELQVALIGLFSEILYRFPNMVVANLTRDSVQEAVVRGITADQILH
FLRVNAHPKALHRVPIVPPTISDQIRLWEMERDRLTFTEGVLYNQFLSQPDFEMLRNYAK
DLGVLLWENNPKRLMVVSKAGHDDVKRYWKTIRKGNS
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgcggggacgaaaaaattggattgtaaagatttgcacggttatttgaagact
ttggggtcgtctctgttagatgaattgtacgggagacctgcaacatgtctggcggtcttc
agggagctgacggaccttgcgaagcactacgtgatgcggctgctgttcctggagcaggca
gtcccacaggccgtggtggggtcatgggtcaccagcggaaaccacagtgagcacctgaga
gctgtgtcccagctatcagagctgcgagtgtggcatgaacaccagatctctggcggcttg
gcgggttggatcctcagtcccaccttcagggcaaacctcaggactgcactgctgggagga
ggcaagccctggttcagtgtcgtgcagctgcctcctgacaaacatgccaaagatgtggct
gcactggatacatactcactggagagatgggaggtcctgctgaatttcatcgtggggtca
ggagaggctcaagtcagtaaagacatcatggagatcctcatcaagtctgggctcatgaag
agtgaggagggcagtctccaccccaccatcacccctgcagggttccagttcctcctgatg
gacacgccctcacaggtgtggtacatcatcctgcagtacctggacaccatgcagagtcga
ggactgaacctggtagaggccttacagtttctttttcaaataagcttttccacgctcggt
aaggactacccgacagagggtatgagtgactccatgcagcagttccttcagcacctgcgt
gagttggggctagtgaaccagcgcaaacggaagtctggaaggttctacccaacaagactc
gccatccaccttgcctcaggtatttcagatgtggagaaagacttccacaaagaggggtac
cttgttgttgagagtaactacagaatatatgcatacacagactcagagctgcaggtggcc
ctgattgggcttttcagtgaaattttgtacagatttcccaacatggtagttgctaacctg
accagagacagtgtacaggaagcagtggtgaggggcatcacggctgatcagattctccac
tttctgcgagtgaatgcacatccaaaggctctccacagagttcccatagttcctcccacg
atcagtgatcagatcaggctatgggagatggaacgggacaggctcactttcactgaaggt
gttttatacaaccagttcctgtcacaacctgactttgagatgctcaggaattatgcaaag
gacttaggagtcttactatgggagaacaaccccaagcgactgatggtggtcagcaaagct
ggacatgacgatgtcaagagatactggaaaaccattcggaaagggaacagctga

DBGET integrated database retrieval system