KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_57224Help
Entry
BRAFLDRAFT_57224  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    BRAFLDRAFT_57224
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BRAFLDRAFT_57224
Enzymes [BR:bfo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     BRAFLDRAFT_57224
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 457 aa AA seqDB search
MFLLLFCSFLLGTCYGQFPRACTDDLSLSTGRCCPLWPTADGTGSPCGEAQGRGTCRQIQ
PDDSPHSPSYPYVGVDDRERWPTVYWNWTCECRDNFYGFDCSECKYGYAGPNCTERKVLI
RRNIFDLSWWERRQFLRALDESKTTMSERWVIPVTPYVDFLTNGTKPAFANVTTYNVLAW
MHYYVSRNVLLPDGGVFESVDFAHEGPVFLPWHRLFLLLWERELARFVDDENFAIPYWDW
RGLDGCGDVCTDDFLGATPQNISGLLSNETVFSDWQVICTRDDEYDALRTVCDGSPEGPL
LRNPGTVPDYSTLPTWQDVLDVLELDQYETPPYDRFANFSFVNSLEGFASPDGIASVRSY
LHNAVHRFMNGTLSSVGSSANDPIFIIHHAYVDSIYEVWLRKFRQENAPIGHNRGSYMVP
FIPLHTPEDFFTLTTDFGYEYDYLIVIGKCTVHVRFL
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtttctgttgcttttttgttcgttccttctcggtacatgttacgggcagttccctcga
gcctgtacggacgatttgagcctctccaccggcaggtgttgccccctgtggccgactgca
gacgggacagggtcgccttgcggggaggctcagggccgaggcacctgccgtcagattcag
ccggacgactcaccccacagccccagctacccctacgtgggagtggacgaccgggaacga
tggccgactgtgtactggaactggacttgtgaatgccgagacaacttttacggcttcgac
tgtagtgagtgtaagtacggctatgcaggacccaactgtaccgaacgaaaggttttaatc
cgtcggaacatcttcgacctgtcgtggtgggagagaagacaatttcttcgagcgctagac
gaaagcaaaaccaccatgagcgagcgttgggtcatccctgtgacgccttacgtcgacttc
cttacaaatggaaccaaaccagcattcgccaacgtcacgacgtacaacgtcttggcctgg
atgcactactacgtctctaggaatgtcctgcttccagacgggggcgtgtttgaatccgta
gacttcgcgcacgagggtccggtcttcttgccgtggcaccgcttgttcttactgctctgg
gagagggaactggccaggttcgtggatgacgagaatttcgccatcccatactgggactgg
cgcggcttggacggctgtggtgacgtctgtacggatgacttcctgggtgccacgcctcag
aacatcagtggactactgagcaatgaaacggtgttctcagactggcaggtcatatgtaca
cgtgatgacgagtatgacgcactccggacggtttgtgacggcagtccggaaggtccgctg
ctccggaaccccgggaccgttccggattactccacccttcccacctggcaggacgtactg
gacgtcttggaactagaccagtacgaaacgcccccttacgacaggttcgcgaacttcagc
ttcgtgaactcactggaaggattcgcttcaccggatggcattgcaagtgtacggagctac
ctgcacaacgctgtccaccgcttcatgaacgggaccctcagctcggtcgggtcgtccgcg
aacgatccgatcttcatcatccatcacgcttacgtggacagtatatatgaggtctggctg
agaaaattcaggcaagaaaacgcccccattggtcacaaccggggttcctacatggtgccg
tttataccccttcacacccccgaagacttcttcacactaactacagacttcgggtatgaa
tatgactacctcattgtgatcggtaagtgcacagttcatgttcggtttttataa

DBGET integrated database retrieval system