KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_57224Help
Entry
BRAFLDRAFT_57224  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:bfo00350]
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:bfo00740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 457 aa AA seqDB search
MFLLLFCSFLLGTCYGQFPRACTDDLSLSTGRCCPLWPTADGTGSPCGEAQGRGTCRQIQ
PDDSPHSPSYPYVGVDDRERWPTVYWNWTCECRDNFYGFDCSECKYGYAGPNCTERKVLI
RRNIFDLSWWERRQFLRALDESKTTMSERWVIPVTPYVDFLTNGTKPAFANVTTYNVLAW
MHYYVSRNVLLPDGGVFESVDFAHEGPVFLPWHRLFLLLWERELARFVDDENFAIPYWDW
RGLDGCGDVCTDDFLGATPQNISGLLSNETVFSDWQVICTRDDEYDALRTVCDGSPEGPL
LRNPGTVPDYSTLPTWQDVLDVLELDQYETPPYDRFANFSFVNSLEGFASPDGIASVRSY
LHNAVHRFMNGTLSSVGSSANDPIFIIHHAYVDSIYEVWLRKFRQENAPIGHNRGSYMVP
FIPLHTPEDFFTLTTDFGYEYDYLIVIGKCTVHVRFL
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtttctgttgcttttttgttcgttccttctcggtacatgttacgggcagttccctcga
gcctgtacggacgatttgagcctctccaccggcaggtgttgccccctgtggccgactgca
gacgggacagggtcgccttgcggggaggctcagggccgaggcacctgccgtcagattcag
ccggacgactcaccccacagccccagctacccctacgtgggagtggacgaccgggaacga
tggccgactgtgtactggaactggacttgtgaatgccgagacaacttttacggcttcgac
tgtagtgagtgtaagtacggctatgcaggacccaactgtaccgaacgaaaggttttaatc
cgtcggaacatcttcgacctgtcgtggtgggagagaagacaatttcttcgagcgctagac
gaaagcaaaaccaccatgagcgagcgttgggtcatccctgtgacgccttacgtcgacttc
cttacaaatggaaccaaaccagcattcgccaacgtcacgacgtacaacgtcttggcctgg
atgcactactacgtctctaggaatgtcctgcttccagacgggggcgtgtttgaatccgta
gacttcgcgcacgagggtccggtcttcttgccgtggcaccgcttgttcttactgctctgg
gagagggaactggccaggttcgtggatgacgagaatttcgccatcccatactgggactgg
cgcggcttggacggctgtggtgacgtctgtacggatgacttcctgggtgccacgcctcag
aacatcagtggactactgagcaatgaaacggtgttctcagactggcaggtcatatgtaca
cgtgatgacgagtatgacgcactccggacggtttgtgacggcagtccggaaggtccgctg
ctccggaaccccgggaccgttccggattactccacccttcccacctggcaggacgtactg
gacgtcttggaactagaccagtacgaaacgcccccttacgacaggttcgcgaacttcagc
ttcgtgaactcactggaaggattcgcttcaccggatggcattgcaagtgtacggagctac
ctgcacaacgctgtccaccgcttcatgaacgggaccctcagctcggtcgggtcgtccgcg
aacgatccgatcttcatcatccatcacgcttacgtggacagtatatatgaggtctggctg
agaaaattcaggcaagaaaacgcccccattggtcacaaccggggttcctacatggtgccg
tttataccccttcacacccccgaagacttcttcacactaactacagacttcgggtatgaa
tatgactacctcattgtgatcggtaagtgcacagttcatgttcggtttttataa

DBGET integrated database retrieval system