KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_57682Help
Entry
BRAFLDRAFT_57682  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bfo00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bfo00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:bfo00471]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 467 aa AA seqDB search
MANLRKLQESHSSFLDRESFSKCITENIVIIGRAFQSKFVIPKFSEFSSYVDKMYWSSVS
RKGGKVADYIPQLARFSPDLWGVALCTVDGQRHSIGDSDKPFCLQSCVKPLVYATAVSEL
GAETVHGYVGTEPSGRPFNEIALNKYNQPFNPMINSGAILLCSLIKPEDHQADRFDHILK
VLKAAAGDDFVGFSNTTFLSEKATGYRNFALAYYLKENKCFPPKTDLMEALDLYFQHCSV
DITCESGAIIAATLANGGVCPLTGELVFHPDAVQHTLSLMHSCGMYDYSGQFAFQVGLPA
KSGVSGGIMLVVPSVMGIMVWSPPLDSTGNSVRGLHFCKELVSTFNFHHYDNLKYKSKKL
DPRRHRDESRSQQIIDILFAAYNGDVTALRRCVMLGMDMEVTDYDGRTALHIAAAEGHLQ
VVRFLLEKCGVRHDLQDRWGQVPLDDAVRFGHKKTEEILLKAKDESG
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggccaacctacgaaagctacaagaatcccacagctcgtttctcgatcgcgaaagcttc
agcaagtgcataacggagaatatcgtaattatcgggcgggccttccagtccaagtttgtt
ataccaaagtttagtgaattctccagctatgtcgacaaaatgtactggtcgagtgtctcg
cgtaagggaggcaaagtagcggattatattccgcagctggcacgtttcagtcctgacctg
tggggcgtggcgctgtgtacagttgacggccagcgacattcaataggagacagcgacaaa
cccttctgcttgcagtcctgtgtcaagcccttggtgtacgcaacagcagtcagcgagctc
ggggctgaaaccgtccacggatatgtcggaactgaacccagcgggaggcctttcaacgaa
attgccttgaacaaatacaatcagcccttcaacccgatgatcaactcaggcgccatcctg
ctgtgttctctcatcaaacctgaggatcatcaagcagacagattcgaccacatcctgaag
gtactgaaagcagctgcaggcgacgactttgtaggctttagcaacaccacttttctgtca
gagaaagccacaggctatcgtaactttgccttagcttactacttaaaggagaacaagtgc
tttccaccaaagacagatctcatggaagctctcgatctatacttccaacactgctcggtt
gacataacgtgcgaatccggtgcaatcatagcggctacgctagcaaacggcggagtgtgc
ccgctaacaggagagctggtgttccatccggacgcagttcagcacacgctgtcgctcatg
cactcctgtggaatgtacgactactcaggacagtttgcgttccaagtcggcctccctgcc
aagtctggagttagcggtggcatcatgttggtggtgcccagtgtgatgggtatcatggtt
tggagcccacccctagatagcacaggtaacagtgttcgaggtctgcacttctgcaaggaa
ctggtctccaccttcaactttcaccactacgacaacctcaagtacaagtccaagaaactg
gatccgagacggcacagggatgaaagtcgcagccagcaaatcatcgacatcctgttcgcc
gcgtacaacggtgacgtgaccgccctgcgccggtgcgtgatgctgggcatggacatggag
gtgacggactacgacggtcgcacggcgctgcacatcgcggcggcggagggccaccttcag
gtggtccggttccttctggagaagtgtggggtacggcacgacctgcaggataggtgggga
caggtaccgctcgacgacgctgtgcgcttcggacacaagaaaactgaggagatactactc
aaggctaaagatgaatctggctag

DBGET integrated database retrieval system