KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_58314Help
Entry
BRAFLDRAFT_58314  CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K00545  catechol O-methyltransferase [EC:2.1.1.6]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00350  Tyrosine metabolism
bfo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    BRAFLDRAFT_58314
Enzymes [BR:bfo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     BRAFLDRAFT_58314
Exosome [BR:bfo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BRAFLDRAFT_58314
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_3 Methyltransf_24 Cons_hypoth95 CmcI Methyltransf_31 Met_10 ATLF
Motif
Other DBs
NCBI-GeneID: 7207125
NCBI-ProteinID: XP_002600922
JGI: 58314
UniProt: C3YS29
AA seq 212 aa AA seqDB search
MSKEQRVLRYVQQNASRGDPDSVLAAVDKFGWETEWAMNVGDVKGLILDRFVKETAPQTM
LELGTYMGYSAIRVVRLLPETAKFLTVEFNPENAAIANEMIAFAGLQNRIIQITSDSADV
IPQLKKKYDVDTFDMVFIDHWKDVYVRDIKLLETNNLLRKGTVVVADNIINPGAPEYADY
VRTCGKYDSTFHESNFEYSDDIDGLEKSVYRG
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagaacagcgggtcctacggtacgttcagcagaacgcgtcccgaggcgacccg
gacagcgtgctggccgccgtggacaagttcggctgggagacggaatgggccatgaatgtt
ggagatgtcaaagggttgatcctggaccggtttgtgaaggagacagcaccacaaaccatg
ctggagctgggcacgtacatggggtactccgccatcagggtcgtcaggctgctgccggaa
acagccaagttcctcacggtggagttcaatccagagaacgccgccatcgctaatgagatg
atcgcatttgcggggttacaaaataggattatccagatcacatctgatagcgctgacgtc
atcccccagctgaagaagaagtatgacgtagacacgttcgatatggtgtttatagaccac
tggaaggacgtctacgtcagagatatcaaattattggaaacaaacaaccttctacgcaaa
ggtactgtagttgtagctgacaacatcatcaacccaggcgccccagagtacgcggactac
gtgcgaacgtgtggcaaatacgactcaacattccacgagagcaatttcgagtacagtgac
gacatcgacgggctggagaagtctgtgtaccgaggctaa

DBGET integrated database retrieval system