KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_58704Help
Entry
BRAFLDRAFT_58704  CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K11252  histone H2B
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Chromosome [BR:bfo03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    BRAFLDRAFT_58704
Exosome [BR:bfo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BRAFLDRAFT_58704
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa LUC7
Motif
Other DBs
NCBI-GeneID: 7219068
NCBI-ProteinID: XP_002612589
JGI: 58704
UniProt: C3XTH2
AA seq 131 aa AA seqDB search
MPPKSINNNNNKVRADSASSPEPGTRPHGKARRRHHRNRKETYNSYIYKVLKQVHPDVGI
SSKAMNIMNSFVNDVFERMAGEASRLAHYNKKQTVSSREIQTVVRLLLPGELAKHAVSEG
TKAVTKYTSTK
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgaagtccatcaacaacaacaacaacaaggtccgcgcggacagcgcttcttca
cctgaacctggcacaaggcctcatgggaaggcacgccgacgtcatcaccggaatcggaaa
gagacgtacaacagctacatctacaaggtgctgaagcaagttcaccctgatgttgggatc
tccagcaaagccatgaacatcatgaactccttcgtgaacgacgtgtttgagcggatggct
ggcgaggcctcgcgactcgcgcactacaacaagaaacagacagtctccagccgagagatc
cagaccgttgtgaggctgctgctgcccggtgagctggccaagcacgcggtcagtgagggg
accaaggccgtcaccaagtacaccagcaccaagtga

DBGET integrated database retrieval system