KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_58861Help
Entry
BRAFLDRAFT_58861  CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00061  Fatty acid biosynthesis
bfo00620  Pyruvate metabolism
bfo00640  Propanoate metabolism
bfo01100  Metabolic pathways
bfo01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BRAFLDRAFT_58861
   00640 Propanoate metabolism
    BRAFLDRAFT_58861
  Lipid metabolism
   00061 Fatty acid biosynthesis
    BRAFLDRAFT_58861
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    BRAFLDRAFT_58861
Enzymes [BR:bfo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     BRAFLDRAFT_58861
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     BRAFLDRAFT_58861
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     BRAFLDRAFT_58861
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carboxyl_trans ACC_central XPC-binding
Motif
Other DBs
NCBI-GeneID: 7217714
NCBI-ProteinID: XP_002589454
JGI: 58861
UniProt: C3ZPP4
AA seq 763 aa AA seqDB search
MVMRYGHRLWKVRVTQAEIKINIRLNHNSNPVPIRLFLNNESGYYLDISLYKEVVNPRTG
QIMFQGYGGKRGPLNGMLLNTPYMTKDHLQAKRFQAQSLGTTYIYDFPEMFRQVCVQLTC
TELVLDSQSQLVEMNRQQGENDIGMVAWKMFLRTPEYPDGREIIVIGNDITHLIGSFGTQ
EDELFKRASELSRSLGVPRLYISANSGARIGMAEEIKHLFKIRWEDPSDPDKGFRYLYLT
PADYKKVSGLNSVHAEHVEEDGESRYKITAVIGKDDGLGVENLRGSGMIAGETSLAYQDV
VTISLDDYGGVLLMLKWLSYVPVHRGAPLPTITPVDPVEREIAFTPTKAPYDPRWMLAGR
KDPENRSVWVSGFFDRDSFLEILHQWAKTVVTGRARLGGIPVGVIAVETRQVELSIPADP
ANLDSEAKVVAQAGQVWFPDSAFKTAQAIRDFNREELPLLIFANWRGFSGGMKDMYDQVL
KFGASIVDGLREYRQPVLVYIPPHGELRGGAWAVVDPTINPEHIEMYADKDSRGGVLEPE
GTVEIKFRRKDLVKTMRRIDSKYQHLINKLSDPSISSADRKSLELRLKEREDQLTPMYHQ
VAVLFADLHDRAGRMQEKGVILETLEWKSSRKFFYWRLRRLLLEGRIHKQISQANKDLSV
AQMQAMLRRWFIEAEGTVKAYEWDNNQSVVQWLEAQLSEEEPHSVIKDNINCLKRDHVLQ
QIRSLVQDNPEVAMDSIVHMTQHMSPSQRNEVARILATMDTSS
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atggtgatgcggtacggacaccgtctgtggaaggttcgggtgacgcaggccgagataaag
atcaacatccggctcaaccacaacagtaacccggtccccatccggctgttcctcaacaat
gagtctgggtactacctggatattagtctgtacaaggaggtggtcaaccccaggactggc
cagatcatgttccaaggctacggagggaagcgcggccccctgaacgggatgttactgaac
actccctacatgactaaggaccatctgcaggccaagaggttccaggctcagtccctgggc
actacctacatctacgactttcctgagatgttcagacaggtatgtgtacagctgacctgc
acagagctggttctggacagccagtcccagctggtggagatgaaccggcagcagggcgag
aacgacatcggcatggtcgcctggaagatgttcctccgcactccggagtaccccgatgga
agggagatcatcgtcatcggcaacgacatcacgcacctgattggctcatttgggacacag
gaggacgagctttttaagagagcctcggagctgtcacgctccctgggcgtgcccagactg
tacatctcagcaaacagcggagctcggatcgggatggccgaggagatcaaacatctcttc
aagatccgctgggaggatcccagtgatccagacaagggcttcagatatctgtacctcact
cctgcagactacaagaaggtgagtgggctgaactcggtccatgcggaacatgtggaggaa
gatggggagtcacgctacaagatcacagctgtaatcggtaaagacgatggactcggagtg
gagaacctgcgtgggtcaggcatgatcgccggggaaacctcgctagcataccaagatgtc
gtcaccatcagcctggatgactatgggggagtcctgctcatgctgaagtggctgtcctac
gtacctgtgcaccgaggcgcccccctccccaccatcaccccagtagatccagtggaacgg
gagatcgccttcaccccaaccaaggccccctacgacccacgatggatgctggctggcagg
aaagacccagaaaaccggagtgtgtgggtgagcgggttctttgaccgtgactcattcctg
gagatcctgcaccagtgggccaagactgtggtcacaggaagggcaagactgggcggcatc
cctgtgggcgtgattgccgtggaaaccaggcaggtagagctatctatcccagcagaccct
gcaaacctggactccgaggcgaaggtggtagcccaggccgggcaggtgtggttccctgac
tccgccttcaagacggctcaggccatcagggacttcaacagggaagaactgccgctgctg
atcttcgctaactggagggggttctcagggggcatgaaagacatgtacgaccaggttctg
aagttcggcgcgagcatcgtggacggtctgcgtgagtaccgccagccggtgctggtgtac
attccgccccacggggagctgaggggcggggcctgggctgtggtcgacccaaccatcaac
ccagaacacatcgagatgtacgcagacaaggacagcagaggaggagtcctggagccagag
gggaccgtggagatcaagttccgcaggaaggacctggtgaagaccatgaggaggatcgac
tccaagtaccagcacctcatcaacaagttatcggacccgagcatctcctcggcggaccgt
aagagcctggagctgcgtctgaaggagcgggaggaccagctgacccccatgtaccaccag
gtcgccgtgctgttcgctgatctgcacgaccgcgcaggcaggatgcaggagaagggcgtc
atactggaaaccttggagtggaagtcgtctcggaagttcttctactggcggctgagacgt
cttctgctggaagggagaatacacaaacagatcagccaagcaaacaaagacctgagtgtt
gcccagatgcaggccatgctgaggaggtggttcatcgaggccgaggggacggttaaggcc
tatgagtgggacaataaccagtcggttgtccagtggttggaggcacagctgagtgaggag
gagccgcactctgtcattaaggacaacatcaactgtctgaagagggaccatgtactgcag
cagattaggagcctggtgcaagacaaccctgaggtggccatggattccatcgtccacatg
acccagcacatgagcccctcccagcgcaacgaggtcgctcggattctggcaaccatggac
acatcgtcctag

DBGET integrated database retrieval system