KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_59014Help
Entry
BRAFLDRAFT_59014  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BRAFLDRAFT_59014
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRAFLDRAFT_59014
   00620 Pyruvate metabolism
    BRAFLDRAFT_59014
   00640 Propanoate metabolism
    BRAFLDRAFT_59014
Enzymes [BR:bfo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BRAFLDRAFT_59014
Lipid biosynthesis proteins [BR:bfo01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BRAFLDRAFT_59014
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 643 aa AA seqDB search
MPEADGFPGVHTHQDLYDFSLREPDTFWGTLAKSRIQWIKSFDRVSDCDMSAGKIEWFLG
GQLNVSVNTLDRHVQKMPDKVALIWERDEPGTEVRITYRELLAMTCQLANTLRSHGVKKG
DRVCIYMPNSPIAVAAMQACARIGAPHSVVFAGFSADALASRIQDANCETVITTDQAVRG
GKVIELKKTVDDAVANCPMVKRVLVAQRTGKEVPMKHNLDFSLEEDMCRQSTECTPEIMD
SEDPLFMLYTSGSTGKPKGILHTQAGYLLYATMTSKFAFDIREDDIFSCVADIGWITGHS
YVVYGPLSNGATTVLFESIPTYPNPGRYWEMVERLKINQFYLAPTAVRLLLKFDESWVKK
YDRSTLRKLGCVGEPLNVEAGDWYSQVVGEGRCDLVDTWWQTETGGIMITPRPSQPGAEI
LHGPMRPFFGIEPVLFNDEGKELTGKDVSGALCVRKPWPGIARTIFGDHERYLDTYFRPY
PGTYFSGDGAHRDHKGYYHITGRMDDVINISGHRIGTAEIEDAMDEHHDVAETAVIGTPH
EVKGEVPYAFVILKEGVRRDEEDIAKELKDLVRKTIAAYAVPDTILITPGLPKTRSGKIM
RRILRKISTDKEEELGDVSTLAEPSVVDAIVQSHKAYKQRIRS
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgccggaggcagacggcttccctggggtccacacccaccaggatttgtacgacttctct
ctgagggaacccgacactttctggggaacacttgcgaagtctcgcatacagtggatcaag
tccttcgaccgtgtgagtgactgtgatatgtcagcagggaagatagagtggtttcttgga
ggccagctcaacgtctcagttaataccttggacagacatgtgcagaaaatgccagacaaa
gtagctctgatttgggagagggatgagccaggaactgaagtgaggattacgtacagggaa
ctcctcgccatgacatgtcagctggctaacactttaaggagccatggagtaaagaaggga
gacagagtgtgcatttacatgcccaactctcccatagctgtggcagccatgcaagcttgt
gcacgaatcggagccccacacagtgtggtgtttgctggcttcagtgctgatgccttggca
agcaggatccaagatgccaactgtgaaacagtgatcacgacagatcaggctgtgagagga
gggaaagtgatcgagctgaagaagactgtggatgatgctgttgccaactgccccatggtg
aagagggtactggtagcacagaggactggcaaagaagttccaatgaaacacaacctggac
ttctccctcgaggaggatatgtgcaggcagtccacagagtgtaccccagagataatggac
agtgaggaccctctgttcatgttgtatacgtccggcagcacaggcaaacccaaggggatc
ctccatacacaggcagggtacctgctgtatgcaaccatgacctccaagtttgcctttgac
atccgtgaagatgacatattcagctgtgtggcagacataggctggatcactggtcacagc
tatgttgtatacggccctctgagtaatggtgccaccactgtgctcttcgaaagcatacct
acttatcccaatccaggtaggtactgggagatggtggagagactgaaaatcaaccagttc
tacctggcccccactgctgtccgactgctgctcaagtttgatgagtcctgggtgaagaag
tatgacaggtccacactcaggaaattggggtgtgttggagagccactgaatgttgaggca
ggtgactggtacagccaggtggtgggggagggcaggtgtgatctggtggacacctggtgg
caaacagaaactggaggcattatgatcacacccagaccctcccagcctggcgctgaaatc
ctacatggtcccatgagacccttctttggaattgaacctgtgctgttcaatgatgaggga
aaggagctgactggcaaggacgtgtcaggtgcgctgtgtgtcaggaaaccctggccaggc
atcgcacggacaatctttggagaccatgagagatatctagacacatacttcagaccctat
ccagggacatacttctcaggggatggagctcacagggatcacaagggttactatcacatc
actggacgcatggatgatgtcattaacatcagtggacacaggattggcacagcagagatt
gaggatgccatggatgaacatcatgatgtagctgaaacagctgtcatcggaactccacat
gaagtaaaaggagaagtaccatatgcatttgtgatcttgaaagaaggagttcgacgtgat
gaggaagacatagccaaggagctgaaggatctggtgaggaaaaccatcgcagcatatgca
gttcctgataccattttgatcacacctggcttacctaagaccagatctgggaagatcatg
agacgaatcttgcgcaagatctccacagacaaagaagaggagttgggagatgtgtccacc
ctggcagagcccagtgttgtagatgccatcgtccaaagtcacaaggcatacaagcaaagg
atcagaagctaa

DBGET integrated database retrieval system