KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_59159Help
Entry
BRAFLDRAFT_59159  CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K08056  protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    BRAFLDRAFT_59159
Enzymes [BR:bfo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     BRAFLDRAFT_59159
Chaperones and folding catalysts [BR:bfo03110]
 Protein folding catalysts
  Protein disulfide isomerase
   BRAFLDRAFT_59159
Membrane trafficking [BR:bfo04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    BRAFLDRAFT_59159
Exosome [BR:bfo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BRAFLDRAFT_59159
  Exosomal proteins of colorectal cancer cells
   BRAFLDRAFT_59159
  Exosomal proteins of bladder cancer cells
   BRAFLDRAFT_59159
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_7 Thioredoxin_8 Thioredoxin_2 AhpC-TSA OST3_OST6
Motif
Other DBs
NCBI-GeneID: 7239481
NCBI-ProteinID: XP_002602037
JGI: 59159
UniProt: C3YNT9
AA seq 440 aa AA seqDB search
MFSWLSLLVVCALARVNADDVLDYSGDDFSDRIGEHDVALVEFFAPWCGHCKRLAPEYEK
AATVLKDNDPPVALVKVDCTSESGGKDTCSKFGVSGYPTLKIFRGGEFSSEYQGPREQNG
IVSFMRKQVGPSAKPVLDKDAMEKFIGNSEPSVVGFFAEDSDLKKAFLKTADNNRDDYRF
AYTEARDVIDKYGYQDDAVVLFYPPRLHNKFEEKQLVYEGKSSENKIKTWLKDNVLGLCG
HMTDGNADKFKKPLVVAYYDVDYVKNAKGSNYWRNRVLKVATKLKEEGKEVYFAIAARGD
FYGQLSEFGLDSSSSDKPVVAARDTSDDKFIMTDEFSVDNLEKFVRDFLDGKVKRYLKSE
PVPEDNDGPVKVVVAENFDEIVMDDTKDVLIEFYAPWCGHCKNLAPKWDELGEKVQQGGR
EVDDFMSFLKRKATHARDEL
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgttcagctggctctctctgctcgtcgtctgcgccttggcgcgcgtgaacgcagacgac
gtcttggactactccggagacgacttttcagaccgtatcggcgaacatgacgtcgctctt
gtggagttcttcgcgccttggtgtggccactgcaagaggcttgctcctgagtacgagaaa
gctgctacagtcctgaaggacaacgaccctcctgtggcactggtgaaggttgactgcacg
tctgaatcaggaggaaaggacacctgcagcaagttcggcgtgagcggctaccccacgctg
aagatcttccgcggcggagaattctcctccgagtaccagggcccacgggaacagaatgga
atcgtcagcttcatgaggaagcaggttggccccagcgctaaaccagttctggacaaggac
gccatggagaagttcatcggcaactccgagcccagcgtcgtaggtttctttgcggaagac
agtgacctgaagaaggctttcctgaagacggcagacaacaaccgcgatgactacaggttt
gcctacaccgaggccagggacgtcatcgacaagtacggataccaggatgatgctgttgtg
ctgttctacccgccccgcctccacaacaagtttgaggagaagcagctggtctacgaagga
aagtcctccgagaacaagatcaagacttggctcaaggacaacgttctgggactgtgcggc
cacatgaccgacggaaatgcagacaagttcaagaagccactggtggtggcttactacgat
gtggactatgtgaaaaatgccaaaggaagtaactactggagaaacagggttttgaaggtt
gccaccaagctgaaggaggaagggaaggaggtttacttcgccatcgccgctcggggagac
ttctatggccagctgtccgagttcggtctggactctagcagctcggacaagccggttgtc
gctgccagggatacaagtgacgacaagttcatcatgacggacgaattcagtgttgacaac
ctggagaagtttgtgcgtgacttcctggacgggaaagtgaagaggtacctgaagtctgag
cctgttcctgaagataacgatggaccagtcaaggttgtcgtggctgagaatttcgacgaa
atcgtcatggacgacacgaaagacgtgctgatagaattctacgctccgtggtgcgggcac
tgcaagaacctggctccaaaatgggacgagctgggagaaaaggtacaacagggtggacga
gaggtcgacgacttcatgtccttcctgaagaggaaagccacacacgcgagggacgagctc
tga

DBGET integrated database retrieval system